Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.65
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 8.1e-10
Disease Target Count Z-score Confidence
Retinopathy of prematurity 21 3.229 1.6
Retinal detachment 33 3.035 1.5

Gene RIF (5)

PMID Text
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
12620395 The protein encoded by this gene is thought to display antimicrobial activity.

AA Sequence

MGLFMIIAILLFQKPTVTEQLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEACKKITKPP      1 - 70
RPKPATLALTLQDYVTIIENFPSLKTQST                                              71 - 99
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18416833 2008 Directional and balancing selection in human beta-defensins.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12620395 2003 Distribution of new human beta-defensin genes clustered on chromosome 20 in functionally different segments of epididymis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10588992 1999 Defensins: key players or bystanders in infection, injury, and repair in the lung?