Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.88
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Otitis Media 49 3.384 1.7

Gene RIF (1)

AA Sequence

MKLLLLTLTVLLLLSQLTPGGTQRCWNLYGKCRYRCSKKERVYVYCINNKMCCVKPKYQPKERWWPF         1 - 67
//

Text Mined References (6)

PMID Year Title