Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.33
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 2.6e-03

Gene RIF (1)

AA Sequence

MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSL      1 - 70
ESTSAV                                                                     71 - 76
//

Text Mined References (6)

PMID Year Title