Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1663 1.1e-03
Disease Target Count Z-score Confidence
pulmonary tuberculosis 8 3.466 1.7

Gene RIF (1)

PMID Text
16033865 The encoded protein is thought to display antimicrobial activity.

AA Sequence

MLPDHFSPLSGDIKLSVLALVVLVVLAQTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKE      1 - 70
KDKLSHIHDQKETSELYI                                                         71 - 88
//

Text Mined References (3)

PMID Year Title
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.