Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.30

Knowledge Summary

Patent

No data available

AA Sequence

MRIAVLFFTIFFFMSQVLPAKGKFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTP      1 - 70
KKD                                                                        71 - 73
//

Text Mined References (3)

PMID Year Title