Property Summary

NCBI Gene PubMed Count 177
PubMed Score 413.97
PubTator Score 339.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
urothelial carcinoma -1.400 2.5e-02
esophageal adenocarcinoma -1.700 3.8e-02
osteosarcoma -2.217 8.5e-04
primary pancreatic ductal adenocarcinoma -1.778 2.5e-02
intraductal papillary-mucinous adenoma (... -1.700 3.1e-02
intraductal papillary-mucinous carcinoma... -4.400 1.8e-03
lung cancer -1.600 7.7e-03
active Crohn's disease -2.109 4.1e-03
ulcerative colitis -2.800 2.5e-08
breast carcinoma -1.500 9.0e-03
interstitial cystitis -2.400 1.7e-03
cystic fibrosis 1.500 1.8e-04
non-inflammatory breast cancer -2.900 2.0e-02
ovarian cancer 2.700 2.1e-03
pituitary cancer -1.900 4.8e-03
chronic rhinosinusitis 1.429 3.1e-02
pancreatic cancer -1.900 2.2e-02

Gene RIF (164)

PMID Text
27029120 Association of infectious pathology of upper respiratory tract and development of periodontitis diseases with markers in DEFB1 (-44G/C) and TLR2 Arg753Gln and Arg677Trp genes was determined.
26968045 DEFB1 polymorphisms alone may not influence pathology susceptibility, however they could possibly concur, together with other factors involved in the genetic control of innate immune system, in the predisposition towards recurrent tonsillitis
26568662 beta-defensin-1 production is dysregulated in the epithelium of patients with chronic obstructive pulmonary disease
26434201 The DEFB1 c.-44C>G polymorphism of the GG protective genotype was much less frequent among multiple sclerosis patients than among the controls.
26377569 dental plaque amount, lactobacilli count, age, and saliva buffer capacity, as well as DEFB1 gene polymorphism, explained a total of 87.8% of variations in DMFT scores.
26232989 Our meta-analysis provides evidence that DEFB1 genetic polymorphisms rs11362G>A, rs1800972C>G and rs1799946G>A are important contributing factors to the development of digestive diseases
26038828 there is a significant link between innate immunity deregulation through disruption of cationic peptides (hBDs) and the potential development of colon cancer.
26028230 Genotypes and alleles of the DEFB1 gene found in long-living individuals can be considered as the factors that increase the probability of longevity and favorable course of age-related diseases.
25939140 Possible association between DEFB1 polymorphisms and in vivo salivary levels of hBD-1 in an Italian population of 40 healthy individuals, finding a genotype-related different expression with two of these polymorphisms: -52G > A and -44C > G.
25815330 A-dependent DEFB1 upregulation below 20 mM predicts in vitro antimicrobial activity as well as glucose- and AA-dependent CAMP and IFNG upregulation.
25683590 beta defensin 1 gene -20G/A, -44C/G and -52G/A single nucleotide polymorphisms were not associated with chronic tonsillitis.
25503380 We found that RNA interference-induced Caspase-12 silencing increased NOD1, hBD1 and hBD2 expression
25417183 We conclude that plant-made recombinant beta-defensins (phBD-1 and phBD-2) are promising antimicrobial substances and have the potential to become additional tools against salmonellosis, particularly when used in combination.
25410996 Our results suggest the involvement of DEFB1 polymorphisms, in particular that of the c.5*G>A SNP, in the susceptibility of women from Northeast Brazil to HPV infection.
25398456 Functional polymorphisms in IL1B and DEFB1 influence susceptibility to mold infection in solid-organ transplant recipients.
25351513 Defensins promote the differentiation into activated CD91(bright) dendritic cells.
25122636 The present finding explains a common defect in male infertility associated with both asthenozoospermia and leukocytospermia, indicating a dual role of DEFB1 in defending male fertility.
25083086 GG genotype of C-44G SNP in DEFB1 gene may result in decreased defensin beta-1 production in diabetes.
25001249 These findings associate DEFB1 5'UTR polymorphisms with HIV-1/AIDS in Mexican women for the first time.
24747281 The concentrations of LL37, alpha-1, beta-1 and beta-2 defensins were determined by ELISA. Serum AMPs did not change during attacks and did not correlate with acute phase reactants.
24658581 hBD-1 suppresses tumor migration and invasion of oral squamous cell carcinoma.
24564045 The salivary beta-defensin concentration was significantly higher in patients with oral mucosal diseases than in healthy volunteers; furthermore, in patients, the concentration was significantly higher before treatment than after treatment.
24498256 Data indicate that CCL2 and IL-10 released from burn patient lineage-CD34+CD31- cells were shown to be responsible for their inhibitory activities on the production of beta-defensin 1 (HBD-1) by epidermal keratinocytes.
24435641 DEFB1 minor haplotypes were also associated with an increased risk of developing Atypical Squamous Cells of Undetermined Significance lesions, being significantly more frequent in HPV negative women with lesions, than without lesions.
24356550 HBD-1 serum levels in chronic kidney disease patients are inversely related to estimated glomerular filtration rate.
24139179 Our findings suggest interplay between hBD-1 and neuroimmunological responses in Alzheimer's disease
24124699 Data suggest that levels of DEFB1 and DEFB2 are highest in colostrum and decrease in human milk over course of lactation; abundance of DEFB1 in colostrum may have protective against upper respiratory infection in infants up to 6 months.
24034632 A possible involvement of DEFB1 gene in inflammatory bowel diseases.
23971939 IRF5, but not TLR4, DEFEB1, or VDR, is associated with the risk of ulcerative colitis in a Han Chinese population.
23964634 genetic variant rs11362 in DEFB 1 influences caries susceptibility in CL/P children. The results support the hypothesis that expression of DEFB 1 in saliva may serve as a biomarker for future caries risk
23712061 hBD-1 increases epithelial impermeability of cultured NHEK monolayers by promoting the development of tight junctions
23592000 A polymorphism in beta-defensin-1 and its protein level were associated with chronic periodontitis in a Chinese population.
23204181 DEFB1 promoter polymorphisms may promote persistent S. aureus colonization by reducing hbd-1 and hbd-3 expression in keratinocytes of human skin.
23204181 DEFB1 polymorphisms promote persistent S. aureus colonization by altering beta-defensin expression in keratinocytes of human skin.
23194186 these observations suggest that there may be an interracial difference in DEFB4/103A copy numbers between admixed populations and a relationship between DEFB1 single nucleotide polymorphisms and DEFB4/103A copy number variation
23185513 The results of the present study showed that HDAC1 controls the expression of DEFB1 in lung epithelial cells by regulating transcriptional accessibility at the DEFB1 promoter.
23150110 Several diseases have been associated with genetic polymorphisms in the hBD-1 encoding gene. Herein we discuss why the biological role of hBD-1 has been overlooked and how hBD-1 can be activated by chemical reduction.
23046822 The association between periodontitis and one polymorphic site on both DEFB1 and CD14 gene, was investigated.
23028900 In the meta-analysis, DEFA6 rs13275170 and DEFB1 rs2738169 had both a 1.3-fold increased odds ratio for gastric cancer.
22522766 No statistically significant differences were observed in the distribution of the genotypic or allelic frequencies of the DEFB1 c.-52G>A and c.-44C>G SNPs among Crohn disease, ulcerative colitis and healthy control subjects
22444247 HBD1 is expressed in tonsils and its levels are reduced in patients with allergic rhinitis.
22391815 The role of Immunosuppressive neutrophils on the production of human beta-defensins (HBDs), important molecules on host antimicrobial innate immunities, by human keratinocytes was studied.
22386945 Binding of peptides corresponding to the carboxy-terminal region of human-beta-defensins-1-3 with model membranes investigated by isothermal titration calorimetry.
22384213 Using a large, unique cohort of pediatric CA-SAB, this study found no significant association between DEFB1 genetic variation or DEFB4/DEFB103 gene copy number and susceptibility for Staphylococcus aureus bacteremia
22323338 Functional single-nucleotide polymorphisms in the DEFB1 gene are associated with systemic lupus erythematosus in Southern Brazilians.
22269973 in children with HIV, TLR9 1635AG genotype and TLR9 [G;G] haplotype were associated with rapid disease progression, whereas the DEFbeta1 -44CG genotype and DEFbeta1 [G;G] haplotype correlated with a better clinical outcome.
22159483 Data suggest that HIV-1 induces a differential expression of human beta defensins, and describe variants of DEFB1, in placenta and suggest these proteins could be involved in protecting against HIV-1 at least early in pregnancy.
22102811 data demonstrate that hBD-1 is a previously-unrecognized component of platelets that displays classic antimicrobial activity and, in addition, signals PMNs to extrude DNA lattices that capture and kill bacteria
22059360 genetic polymorphism is associated with atopic dermatitis susceptibility and severity
22050386 There were no significant differences in the genotype frequencies of the three single-nucleotide polymorphisms of the DEFB1 gene between the patients with stroke and healthy blood donors
21983064 Oxidation and reduction modulate the activity of human beta-defensin 1.
21843332 Under the condition of bisphosphonate-associated osteonecrosis of the jaws an increased expression of hBD-1,-2,-3 is detectable.
21818276 Expression of human DEFB1 is upregulated and related to the decrease in pulmonary function in patients with chronic obstructive pulmonary disease.
21631237 The stimulation of human fetal membranes with S. agalactiae induced a differential and tissue-specific profile of HBD-1, HBD-2, and HBD-3 secretion.
21551252 hBD-1 may play a role in preventing viral replication in immune cells
21520074 Human beta-defensin 1 exhibits further functions than antimicrobial peptide activity in cultured bone cells, including stimulation of proliferation and differentiation.
21280982 hBD-1 might function as a tumor suppressor gene in oral squamous cell carcinoma, while hBD-2 and -3 might be protooncogenes.
21248850 reduced hBD-1 shields the healthy epithelium against colonisation by commensal bacteria and opportunistic fungi
21122132 In comparison with basal conditions, the secretion profile of HBD1 remained without significant changes when exposes to E. coli
21087323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21077791 Results reinforce DEFB1 as a candidate modifier gene of the CF pulmonary phenotype.
21077791 Observational study of gene-disease association. (HuGE Navigator)
20858604 beta-defensin copy number was assessed in more than 1500 United kingdom DNA samples including more than 1000 cases of Crohn's disease.
20720450 The variations in the genes encoding human beta-defensin-1 and -2 may be associated with the risk of severe acute pancreatitis.
20720450 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20650771 There was no change in expression of hBD-1 in patients receiving endoscopic sinus surgery for chronic sinusitis.
20618959 The beta-defensin antimicrobial peptides hBD1, hBD2 and hBD3 were expressed by immature dendritic cells as well as gingival epithelial cells.
20618470 analysis of DEFB1 haplotypes did not highlight any association of the three single nucleotide polymorphisms with atopic dermatitis development or disease severity
20618470 Observational study of gene-disease association. (HuGE Navigator)
20526610 The tear film per se contains so much antimicrobial substances that epithelial induction of beta-defensin 1 occurs only as a result of ocular surface damage.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20371866 We found a high-caries-experience haplotype (GCA), which increased DMFT scores two-fold, and a low- caries-experience haplotype (ACG), which decreased DMFT scores two-fold, in the DEFB1 promoter.
20371866 Observational study of gene-disease association. (HuGE Navigator)
20305815 HNP-1 (alpha), HBD-2 (beta) and RTD-1 (theta) have anti-HIV-1 activity, but different mechanisms of action
20237496 Observational study of gene-disease association. (HuGE Navigator)
20193032 DEFB1 allele, genotype and haplotype frequencies of CF patients globally considered were similar to those of healthy controls.
20193032 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20128731 The hBD1 mRNA was significantly lower in patients with active CD compared with patients on diet modification.
20100591 This gene encodes a peptide with antimicrobial activity against S. aureus and H. influenzae.
20060856 5'-UTR gene polymorphism affects mRNA secondary structure and its translation efficiency
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20016407 Hematological failure was present more often in UK patients with the DEFB1 -44 G/G genotype compared with the C allele carriers (odds ratio, 2.17; 95% confidence interval, 1.22-3.85).
20016407 Observational study of gene-disease association. (HuGE Navigator)
19954367 leukemic patients carrying untranslated variants of hBD-1 display a higher susceptibility to herpes viruses infections
19954367 Observational study of gene-disease association. (HuGE Navigator)
19829306 A 3' UTR transition within DEFB1 is associated with chronic and aggressive periodontitis.
19829306 Observational study of gene-disease association. (HuGE Navigator)
19811257 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19741426 Authors identified and genotyped five single nucleotide polymorphisms (SNPs) in HBD1 in melanoma.
19706017 Observational study of gene-disease association. (HuGE Navigator)
19702947 HBD-1 basal messenger RNA expression was significantly lower in OSCC. The ability to be induced was significantly reduced in OSCC. 4 HBD-1 SNPs were differentially distributed between cancer and control populations.
19590686 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19516112 Observational study of gene-disease association. (HuGE Navigator)
19477909 HNP-1 and HBD-1 promoted the up-regulation of CD91 on the DC surface
19460328 Studied the association of three single nucleotide polymorphisms (SNPs) in the beta-defensin 1 gene with leprosy susceptibility; SNP 668C probably abrogates NF-kappaB-dependent DEFB1 upregulation leading to lepromatous leprosy variant.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19390326 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19194307 Observational study of gene-disease association. (HuGE Navigator)
19141978 There was no significant difference in hBD-1 expression between patients and controls.
19135873 the DEFB1 gene has a main effect on the skin inflammation and/or skin responsiveness to any kind of allergic reaction.
19135873 Observational study of gene-disease association. (HuGE Navigator)
19118900 PAX2 oncogene suppresses hBD1 expression in cancer and further implicate PAX2 as a novel therapeutic target for prostate cancer treatment.
19080508 The concentrations of human defensin 5, HBD1, and HBD2 in vulvovaginal candidiasis patients were higher than in controls.
18991164 The results of these genetic and in vitro experiments suggest that not only the inducible, but also the constitutive form of hBD may be important in the pathogenesis of H. pylori-induced gastritis.
18991164 Observational study of gene-disease association. (HuGE Navigator)
18938660 Genetic variations in the DEFB1 gene encoding constitutive human beta-defensin 1 may be associated with the risk for Crohn's disease and may determine disease phenotype, e.g. colonic localization.
18938660 Observational study of gene-disease association. (HuGE Navigator)
18840281 HBD-1 was distributed in the cytoplasm of healthy salivary glands and benign salivary gland tumours but seems to migrate into the nucleus of malignant salivary gland tumours.
18817538 Data indicate that the DEFB1 promoter carries functional variants and support previous hypotheses whereby alleles predisposing to atopic disorders are widespread in modern societies because they conferred resistance to pathogens in ancient settings.
18717821 The authors show that enteric pathogens suppress LL-37 and HBD-1 expression in the intestinal epithelial cells (IECs) with Vibrio cholerae and enterotoxigenic Escherichia coli (ETEC) exerting the most dramatic effects.
18627502 expression was found even in non-inflamed pseudocysts such as mucoceles
18614876 Observational study of gene-disease association. (HuGE Navigator)
18566581 Human beta-defensins-1 and -2 are often up-regulated in human lung tumors
18511430 Suggest decreased urinary beta-defensin-1 expression as a biomarker of response to arsenic.
18452706 Francisella tularensis LVS infection has a moderate effect on the level of hBD-1 in airway epithelial cells.
18433872 hBD-1 expression is mediated by c-Myc and the CLOCK:BMAL1 heterodimer, whereas CRY1 expression represses this complex.
18397186 variants in human beta-defensin 1 gene are inversely associated with antiglycan antibodies, further confirming an important role for innate immunity in the pathogenesis of CD.
18397186 Observational study of gene-disease association. (HuGE Navigator)
18346877 The expression of hBD-1 was reduced in all lesions (5-fold in irritation fibroma and 2.5-fold in leukoplakia), but most significantly (50-fold) in OSCC. hBD-1 appears to play a role in the development of OSCC.
18059266 Observational study of gene-disease association. (HuGE Navigator)
17960157 Association of DEFB1 gene polymorphisms with Pseudomonas aeruginosa airway colonization in cystic fibrosis is reported.
17960157 Observational study of gene-disease association. (HuGE Navigator)
17921115 Our results showed that the MBL2 gene is expressed by cells in the basal lamina, whilst DEFB1 is expressed by epithelial cells.
17760820 human beta defensin-1 genes in the gingival epithelium show differential expression in patients with specific periodontal diseases, and aggressive and chronic periodontitis types demonstrate different gingival beta defensin-1 expression patterns.
17508030 Observational study of gene-disease association. (HuGE Navigator)
17508030 These findings provide further evidence that beta-defensin 1 may play a role in the pathogenesis of severe sepsis.
17415576 As compared to healthy controls, skin of patients with mycosis fungoides (non-lesional and lesional) and atopic dermatitis patients showed significantly lower hBD-1 mRNA expression and significantly higher hBD-2 and hBD-3 mRNA expression.
17361499 Observational study of gene-disease association. (HuGE Navigator)
17361499 Five single nucleotide polymorphisms (SNPs) in Defensin Beta-1 (DEFB1) were genotyped in the Boston Early-Onset COPD Study families; none was significantly associated.
17187760 The increased expression of hBD-1 mRNA in cultured HMCs in high glucose suggests a role for hBD-1 in the molecular pathways induced during hyperglycemia.
17108702 The genotypes associated with Atopic Dermatitis and no other allergy were 692 GG (OR = 3.21, 95% CI 1.37-7.34) and 1654 AA (OR = 17.37, 95% CI 1.62-860.83).
17108702 Observational study of gene-disease association. (HuGE Navigator)
17071614 biochemical analysis of human beta-defensin 1
16984277 Observational study of genotype prevalence. (HuGE Navigator)
16741514 hyphal-invasion-dependent inhibition of defensin expression in oral epithelium that undermines the host surveillance system represents a hitherto undescribed novel pathogenic mechanism of C. albicans
16700921 Subjects were genotyped for alpha-defensin-1/alpha-defensin-3, and four beta-defensin-1 polymorphisms. These polymorphisms may not be important in abnormally rapid lung function decline or susceptibility to lower respiratory infections.
16572527 Observational study of gene-disease association. (HuGE Navigator)
16572527 We evaluated the frequency of three SNPs (-52 G/A, -44 C/G; -20 G/A) in the 5' UTR of DEFB-1 gene, in a cohort of 130 HIV-1 infected mothers and their children
16512757 Observational study of gene-disease association. (HuGE Navigator)
16435024 There is significant genetic association between asthma, atopy, and DEFB1, as well as significant interethnic differences in frequencies of DEFB1 single nucleotide polymorphisms between Chinese and Caucasian.
16435024 Observational study of gene-disease association. (HuGE Navigator)
15829297 The expression of HBD1 and two other beta-defensins was correlated with induction profiles in gingival keratinocytes.
15820309 Observational study of gene-disease association. (HuGE Navigator)
15696078 Observational study of gene-disease association. (HuGE Navigator)
15696078 Variation in DEFB1 contributes to asthma diagnosis, with apparent gender-specific effects.
15382127 in the intrahepatic biliary tree, hBD-2 is expressed in response to local infection and/or active inflammation, whereas hBD-1 may constitute a preexisting component of the biliary antimicrobial defense system
15322010 Proteus mirabilis ZapA metalloprotease readily cleaves BD1 and this proteolysis results in significantly reduced bactericidal activity
15317821 beta-defensin tertiary structure has a role in its antimicrobial activity
15242954 Observational study of gene-disease association. (HuGE Navigator)
14707135 hBD-2 expression is promoted by gangliosides acting as co-receptors with TLR5 for FliC via mitogen-activated protein kinase
14703118 the level of expression of hBD-1 mRNA is lower and that of hBD-3 was higher than that of hBD-2 in reconstructed epidermis
12727027 Expression of mRNA is upregulated during differentation of keratinocyte immortalized cell lines.
12695553 DEFB1 is down-regulated in human prostatic and renal carcinomas.
12537649 Observational study of genotype prevalence. (HuGE Navigator)
12517831 Observational study of gene-disease association. (HuGE Navigator)
12381917 Proximal and distal RTC showed constitutive expression of human beta-defensin 1 and human beta-defensin.
11829455 Observational study of gene-disease association. (HuGE Navigator)
11829455 a Ile38 variant was observed in 15.0% of patients but only in 2.8% of healthy individuals and significantly associated with the disease (OR = 6.1, 95% CI 2.0-8.3, P = 0.0012); Variations in hBD-1 may define a high-risk subgroup of COPD
11741980 HBD-3 is a dimer, while HBD-1 and HBD-2 are monomeric. Subsequently, the NMR solution structures of HBD1 and HBD3 were determined using standard homonuclear techniques and compared with the previously determined solution structure of HBD2

AA Sequence

MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK        1 - 68
//

Text Mined References (178)

PMID Year Title
27029120 [ASSOCIATION OF POLYMORPHIC MARKERS IN GENES OF INNATE IMMUNITY IN PATIENTS WITH PERIODONTITIS AND INFLAMMATORY DISEASES OF UPPER RESPIRATORY TRACT].
26968045 2016 DEFB1 polymorphisms and susceptibility to recurrent tonsillitis in Italian children.
26568662 2015 Airway ?-Defensin-1 Protein Is Elevated in COPD and Severe Asthma.
26434201 2015 GENETIC POLYMORPHISMS OF HUMAN ?-DEFENSINS IN PATIENTS WITH MULTIPLE SCLEROSIS.
26377569 2016 Gene-environment Interactions in the Etiology of Dental Caries.
26232989 2015 Association between Genetic Polymorphisms in DEFB1 and Susceptibility to Digestive Diseases.
26038828 2015 Expression and new exon mutations of the human Beta defensins and their association on colon cancer development.
26028230 2015 Association of Polymorphisms in Innate Immunity Genes TLR9 and DEFB1 with Human Longevity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25939140 2015 Impact of DEFB1 gene regulatory polymorphisms on hBD-1 salivary concentration.
25815330 2015 Ascorbic acid, ultraviolet C rays, and glucose but not hyperthermia are elicitors of human ?-defensin 1 mRNA in normal keratinocytes.
25683590 2015 Chronic tonsillitis is not associated with beta defensin 1 gene polymorphisms in Turkish population.
25503380 2014 Caspase-12 silencing attenuates inhibitory effects of cigarette smoke extract on NOD1 signaling and hBDs expression in human oral mucosal epithelial cells.
25417183 2015 Utilization of plant-derived recombinant human ?-defensins (hBD-1 and hBD-2) for averting salmonellosis.
25410996 2014 DEFB1 polymorphisms are involved in susceptibility to human papillomavirus infection in Brazilian gynaecological patients.
25398456 2015 IL1B and DEFB1 Polymorphisms Increase Susceptibility to Invasive Mold Infection After Solid-Organ Transplantation.
25351513 2015 Bright expression of CD91 identifies highly activated human dendritic cells that can be expanded by defensins.
25122636 2014 Deficient human ?-defensin 1 underlies male infertility associated with poor sperm motility and genital tract infection.
25083086 2014 Relevance of ?-defensins (HNP1-3) and defensin ?-1 in diabetes.
25001249 2014 DEFB1 5'UTR polymorphisms modulate the risk of HIV-1 infection in Mexican women.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24747281 2014 Serum antimicrobial peptides in patients with familial Mediterranean fever.
24658581 2014 Human beta-defensin-1 suppresses tumor migration and invasion and is an independent predictor for survival of oral squamous cell carcinoma patients.
24564045 2013 Evaluation of hbetaD-1 and hbetaD-2 levels in saliva of patients with oral mucosal diseases.
24498256 2014 Lineage -CD34+CD31+ cells that appear in association with severe burn injury are inhibitory on the production of antimicrobial peptides by epidermal keratinocytes.
24435641 2014 Beta defensin-1 gene polymorphisms and susceptibility to atypical squamous cells of undetermined significance lesions in Italian gynecological patients.
24356550 2013 Profile of human ?-defensins 1,2 and proinflammatory cytokines (TNF-?, IL-6) in patients with chronic kidney disease.
24139179 2013 Antimicrobial peptide ?-defensin-1 expression is upregulated in Alzheimer's brain.
24124699 2014 Identification of sociodemographic and clinical factors associated with the levels of human ?-defensin-1 and human ?-defensin-2 in the human milk of Han Chinese.
24034632 2014 DEFB1 gene 5' untranslated region (UTR) polymorphisms are marginally involved in inflammatory bowel disease in south Brazilians.
23971939 2013 IRF5, but not TLR4, DEFB1, or VDR, is associated with the risk of ulcerative colitis in a Han Chinese population.
23964634 2014 Genetic variation in the promoter region of beta-defensin 1 (DEFB 1) is associated with high caries experience in children born with cleft lip and palate.
23712061 2013 Human beta defensin-1 regulates the development of tight junctions in cultured human epidermal keratinocytes.
23592000 2013 Association of cytokines, high sensitive C-reactive protein, VEGF and beta-defensin-1 gene polymorphisms and their protein expressions with chronic periodontitis in the Chinese population.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23204181 2013 Impaired ?-defensin expression in human skin links DEFB1 promoter polymorphisms with persistent Staphylococcus aureus nasal carriage.
23194186 2013 Variation in human ?-defensin genes: new insights from a multi-population study.
23185513 2012 Histone deacetylase (HDAC) 1 controls the expression of beta defensin 1 in human lung epithelial cells.
23150110 2012 [Human beta-defensin 1: from defence to offence].
23046822 2012 Clinical application of human ?-defensin and CD14 gene polymorphism in evaluating the status of chronic inflammation.
23028900 2012 Innate immunity and non-Hodgkin's lymphoma (NHL) related genes in a nested case-control study for gastric cancer risk.
22522766 2012 DEFB1 gene 5' untranslated region (UTR) polymorphisms in inflammatory bowel diseases.
22444247 2012 Reduced tonsillar expression of human ?-defensin 1, 2 and 3 in allergic rhinitis.
22391815 2012 Impaired ability of burn patient neutrophils to stimulate ?-defensin production by keratinocytes.
22386945 2012 Binding of peptides corresponding to the carboxy-terminal region of human-?-defensins-1-3 with model membranes investigated by isothermal titration calorimetry.
22384213 2012 Genetic variability in beta-defensins is not associated with susceptibility to Staphylococcus aureus bacteremia.
22323338 2012 Functional single-nucleotide polymorphisms in the DEFB1 gene are associated with systemic lupus erythematosus in Southern Brazilians.
22269973 2012 Polymorphisms of innate immunity genes influence disease progression in HIV-1-infected children.
22159483 2011 Differential expression of human beta defensins in placenta and detection of allelic variants in the DEFB1 gene from HIV-1 positive mothers.
22102811 2011 Novel anti-bacterial activities of ?-defensin 1 in human platelets: suppression of pathogen growth and signaling of neutrophil extracellular trap formation.
22059360 2009 Association of beta-defensin 1 single nucleotide polymorphism with atopic dermatitis.
22050386 2012 Genetic polymorphisms of human ?-defensins in patients with ischemic stroke.
21983064 Waking the wimp: redox-modulation activates human beta-defensin 1.
21843332 2011 Increased human defensine levels hint at an inflammatory etiology of bisphosphonate-associated osteonecrosis of the jaw: an immunohistological study.
21818276 2011 Increased expression of beta-defensin 1 (DEFB1) in chronic obstructive pulmonary disease.
21631237 2012 Evidence of in vitro differential secretion of human beta-defensins-1, -2, and -3 after selective exposure to Streptococcus agalactiae in human fetal membranes.
21551252 2011 Modulation of human beta-defensin-1 (hBD-1) in plasmacytoid dendritic cells (PDC), monocytes, and epithelial cells by influenza virus, Herpes simplex virus, and Sendai virus and its possible role in innate immunity.
21520074 2012 Human ?-defensins differently affect proliferation, differentiation, and mineralization of osteoblast-like MG63 cells.
21280982 2011 Human beta-defensin-1, -2, and -3 exhibit opposite effects on oral squamous cell carcinoma cell proliferation.
21248850 2011 Reduction of disulphide bonds unmasks potent antimicrobial activity of human ?-defensin 1.
21122132 2010 Tissue-specific human beta-defensins (HBD)1, HBD2, and HBD3 secretion from human extra-placental membranes stimulated with Escherichia coli.
21115716 2011 Role of defensins in corneal epithelial barrier function against Pseudomonas aeruginosa traversal.
21087323 2010 Hint for association of single nucleotide polymorphisms and haplotype in SPINK5 gene with atopic dermatitis in Koreans.
21077791 2011 A polymorphism in the 5' UTR of the DEFB1 gene is associated with the lung phenotype in F508del homozygous Italian cystic fibrosis patients.
20858604 2010 Measurement methods and accuracy in copy number variation: failure to replicate associations of beta-defensin copy number with Crohn's disease.
20720450 2010 Polymorphisms of beta defensins are associated with the risk of severe acute pancreatitis.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20650771 2010 [Expression of human beta-defensin after endoscopic sinus surgery for chronic sinusitis].
20618959 2010 Differential and coordinated expression of defensins and cytokines by gingival epithelial cells and dendritic cells in response to oral bacteria.
20618470 2010 Beta defensin-1 gene (DEFB1) polymorphisms are not associated with atopic dermatitis in children and adolescents from northeast Brazil (Recife, Pernambuco).
20526610 2010 Roles of human beta-defensins in innate immune defense at the ocular surface: arming and alarming corneal and conjunctival epithelial cells.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20371866 2010 The antimicrobial peptide DEFB1 is associated with caries.
20305815 2010 Cyclic and acyclic defensins inhibit human immunodeficiency virus type-1 replication by different mechanisms.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20193032 2010 Analysis of DEFB1 regulatory SNPs in cystic fibrosis patients from North-Eastern Italy.
20128731 2010 Low expression of human beta-defensin 1 in duodenum of celiac patients is partially restored by a gluten-free diet.
20100591 2010 Human beta-defensin 1: a restless warrior against allergies, infections and cancer.
20060856 2010 The sound of silence: human beta-defensin-1 gene untranslated SNPs change the predicted mRNA secondary structure in a length-dependent manner.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20016407 2010 Polymorphisms in PARP, IL1B, IL4, IL10, C1INH, DEFB1, and DEFA4 in meningococcal disease in three populations.
19954367 2009 Association between DEFB1 gene haplotype and herpes viruses seroprevalence in children with acute lymphoblastic leukemia.
19829306 2010 A 3' UTR transition within DEFB1 is associated with chronic and aggressive periodontitis.
19811257 2009 Functional polymorphisms of DEFB1 gene in type 1 diabetes Brazilian children.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19741426 2009 Human beta-defensins (HBD1 and HBD3) and malignant melanoma susceptibility.
19706017 2010 ?-Defensin 1 haplotype associated with postoperative endophthalmitis.
19702947 2009 Loss of human beta-defensin 1, 2, and 3 expression in oral squamous cell carcinoma.
19590686 2009 Postural changes in blood pressure associated with interactions between candidate genes for chronic respiratory diseases and exposure to particulate matter.
19516112 2009 Are defensin beta 1 gene polymorphisms associated with HIV infection and virus replication?
19477909 2009 Human defensins activate monocyte-derived dendritic cells, promote the production of proinflammatory cytokines, and up-regulate the surface expression of CD91.
19460328 2009 SNP 668C (-44) alters a NF-kappaB1 putative binding site in non-coding strand of human beta-defensin 1 (DEFB1) and is associated with lepromatous leprosy.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19390326 2009 Role of beta-defensin-1 polymorphisms in mother-to-child transmission of HIV-1.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19194307 2009 Copy number variation of defensin genes and HIV infection in Brazilian children.
19141978 2008 [Expression and significance of human beta-defensin in recurrent nasal polyps].
19135873 2009 Single nucleotide polymorphisms and the haplotype in the DEFB1 gene are associated with atopic dermatitis in a Korean population.
19118900 2009 PAX2 oncogene negatively regulates the expression of the host defense peptide human beta defensin-1 in prostate cancer.
19080508 2008 [Study on vaginal production of human defensins and the correlated pathogenetic factors of vulvovaginal candidiasis].
18991164 2009 Potential role of human beta-defensin 1 in Helicobacter pylori-induced gastritis.
18938660 2008 Association of beta-defensin 1 single nucleotide polymorphisms with Crohn's disease.
18840281 2008 Nuclear hBD-1 accumulation in malignant salivary gland tumours.
18817538 2008 The signature of long-standing balancing selection at the human defensin beta-1 promoter.
18717821 2008 Bacterial exotoxins downregulate cathelicidin (hCAP-18/LL-37) and human beta-defensin 1 (HBD-1) expression in the intestinal epithelial cells.
18627502 2008 Expression of human beta-defensin -1, -2, and -3 in non-inflamed pseudocyst, mucoceles.
18614876 2008 Single-nucleotide polymorphisms in human beta-defensin-1 gene in Mozambican HIV-1-infected women and correlation with virologic parameters.
18566581 2008 Expression of human beta-defensins-1, 2 and 4 mRNA in human lung tumor tissue: a pilot study.
18511430 2008 Decreased urinary beta-defensin-1 expression as a biomarker of response to arsenic.
18452706 2008 Antimicrobial activity of human beta-defensins and induction by Francisella.
18433872 2008 Expression of human beta-defensin 1 is regulated via c-Myc and the biological clock.
18397186 2008 Interaction between seroreactivity to microbial antigens and genetics in Crohn's disease: is there a role for defensins?
18346877 2008 Decreased gene expression of human beta-defensin-1 in the development of squamous cell carcinoma of the oral cavity.
18059266 2008 Psoriasis is associated with increased beta-defensin genomic copy number.
17960157 2008 Association of beta-defensin-1 gene polymorphisms with Pseudomonas aeruginosa airway colonization in cystic fibrosis.
17921115 The expression of innate immunity genes in Italian Crohn disease patients.
17760820 2007 Human beta defensin-1 and -2 expression in the gingiva of patients with specific periodontal diseases.
17508030 2007 Genomic variations within DEFB1 are associated with the susceptibility to and the fatal outcome of severe sepsis in Chinese Han population.
17415576 2007 Expression of human beta-defensins in patients with mycosis fungoides.
17361499 2006 Genetic linkage and association analysis of COPD-related traits on chromosome 8p.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17187760 2007 Glucose regulation of beta-defensin-1 mRNA in human renal cells.
17108702 2007 Association of beta-defensin 1 single nucleotide polymorphisms with atopic dermatitis.
17071614 2007 Studies of the biological properties of human beta-defensin 1.
16984277 2006 SNPs in human beta-defensin 1 gene (DEFB1): frequencies in a Mexican population and new PCR-RFLPs assays.
16741514 2006 Hyphal invasion of Candida albicans inhibits the expression of human beta-defensins in experimental oral candidiasis.
16700921 2006 Contribution of alpha- and beta-defensins to lung function decline and infection in smokers: an association study.
16572527 2006 DEFB-1 genetic polymorphism screening in HIV-1 positive pregnant women and their children.
16512757 2006 No association between selected candidate gene polymorphisms and severe chronic periodontitis.
16435024 2006 Asthma and atopy are associated with DEFB1 polymorphisms in Chinese children.
15829297 2005 Correlation between beta-defensin expression and induction profiles in gingival keratinocytes.
15820309 2005 Distribution of human beta-defensin polymorphisms in various control and cystic fibrosis populations.
15696078 2005 Association of defensin beta-1 gene polymorphisms with asthma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15382127 2004 Peptide antibiotic human beta-defensin-1 and -2 contribute to antimicrobial defense of the intrahepatic biliary tree.
15322010 2004 Proteus mirabilis ZapA metalloprotease degrades a broad spectrum of substrates, including antimicrobial peptides.
15317821 2004 Structure-activity relationships in defensin dimers: a novel link between beta-defensin tertiary structure and antimicrobial activity.
15242954 2004 Novel hairpin-shaped primer assay to study the association of the -44 single-nucleotide polymorphism of the DEFB1 gene with early-onset periodontal disease.
14707135 2004 Gangliosides act as co-receptors for Salmonella enteritidis FliC and promote FliC induction of human beta-defensin-2 expression in Caco-2 cells.
14703118 2003 Use of human reconstructed epidermis to analyze the regulation of beta-defensin hBD-1, hBD-2, and hBD-3 expression in response to LPS.
12860195 2003 Antimicrobial peptides in the first line defence of human colon mucosa.
12728165 2003 Increased concentrations of human beta-defensins in plasma and bronchoalveolar lavage fluid of patients with diffuse panbronchiolitis.
12727027 2003 Upregulated expression of human beta defensin-1 and -3 mRNA during differentiation of keratinocyte immortalized cell lines, HaCaT and PHK16-0b.
12695553 2003 Cancer-specific loss of beta-defensin 1 in renal and prostatic carcinomas.
12537649 2002 Single-nucleotide polymorphisms and haplotype analysis in beta-defensin genes in different ethnic populations.
12517831 2003 Single-nucleotide polymorphisms (SNPs) in human beta-defensin 1: high-throughput SNP assays and association with Candida carriage in type I diabetics and nondiabetic controls.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12381917 2002 Bactericidal activity of renal tubular cells: the putative role of human beta-defensins.
12153515 2002 Expression of beta-defensin 1 and 2 mRNA by human monocytes, macrophages and dendritic cells.
12149255 2002 The structure of human macrophage inflammatory protein-3alpha /CCL20. Linking antimicrobial and CC chemokine receptor-6-binding activities with human beta-defensins.
12054642 2002 Structural and functional characterization of hBD-1(Ser35), a peptide deduced from a DEFB1 polymorphism.
12010514 2002 Chemical synthesis of beta-defensins and LEAP-1/hepcidin.
11829455 2002 Genetic variants of human beta-defensin-1 and chronic obstructive pulmonary disease.
11741980 2002 The solution structures of the human beta-defensins lead to a better understanding of the potent bactericidal activity of HBD3 against Staphylococcus aureus.
11714914 2001 Structure determination of human and murine beta-defensins reveals structural conservation in the absence of significant sequence similarity.
11486002 2001 The structure of human beta-defensin-1: new insights into structural properties of beta-defensins.
11453504 Production of beta-defensin antimicrobial peptides by maxillary sinus mucosa.
11442756 2001 Expression of the peptide antibiotics human beta defensin-1 and human beta defensin-2 in normal human skin.
11148522 2001 Abundant human beta-defensin-1 expression in milk and mammary gland epithelium.
11023262 2000 Expression of the antimicrobial peptide, human beta-defensin 1, in duct cells of minor salivary glands and detection in saliva.
10879797 2000 Beta-defensin expression in human mammary gland epithelia.
10521347 1999 Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6.
10456939 1999 Human beta-defensin-1 mRNA is transcribed in tympanic membrane and adjacent auditory canal epithelium.
10338476 1999 Production of beta-defensin antimicrobial peptides by the oral mucosa and salivary glands.
10223729 1999 Epithelial defensins impair adenoviral infection: implication for adenovirus-mediated gene therapy.
10213993 1999 [A study of human beta-defensin-1 and human beta-defensin-2 in airway mucosal defense].
9875146 1998 Localization of expression of human beta defensin-1 in the pancreas and kidney.
9541493 1998 Human beta-defensin-1: an antimicrobial peptide of urogenital tissues.
9268634 1997 The human beta-defensin-1 and alpha-defensins are encoded by adjacent genes: two peptide families with differing disulfide topology share a common ancestry.
9070620 1997 Human airway epithelia express a beta-defensin.
9038346 1997 Human beta-defensin-1 is a salt-sensitive antibiotic in lung that is inactivated in cystic fibrosis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7667395 1995 Defensins.
7628632 1995 hBD-1: a novel beta-defensin from human plasma.