Property Summary

NCBI Gene PubMed Count 60
PubMed Score 82.86
PubTator Score 125.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
ulcerative colitis 4.800 8.2e-04
lung cancer 6.900 3.7e-07
active Crohn's disease 4.401 1.8e-02

Gene RIF (55)

PMID Text
26206286 a moderately active linear peptide derived from the alpha-defensin HD5 can be engineered to enhance antimicrobial activity almost comparable to the native peptide.
25970658 The study used ion mobility coupled to mass spectrometry to track the structural changes in HD-5 upon disulfide bond reduction.
25664683 HD5ox, at least in part, exerts its antibacterial activity against E. coli and other Gram-negative microbes in the cytoplasm.
25540379 These data support a model in which HD5 prevents furin from accessing human papillomavirus 16 L2 by occluding the furin cleavage site via direct binding to the viral capsid.
25517613 Enteric alpha-defensin HD5 and beta-defensin hBD2 shared similar toxin-unfolding effects with HNP1, albeit to different degrees.
25433720 Authors show that although NOD2 by itself can slightly up-regulate expression of HD5 and HD6, it can strongly down-regulates their expression during differentiation of the Paneth cell lineage mainly by inhibiting activation of the MAPK pathway.
25430675 The study reports the screening of human defensin 5 against the Keio Collection of E. coli strains and shows how this important hostdefense peptide kills bacteria and how bacteria protect themselves against the attack from the human host.
25196670 our results highlight the potential contribution of altered alpha-defensin HD-5 expression in the formation of a viral/tumour-permissive environment in high-risk HPV infection and progression to cancer of the uterine cervix
24681099 Data indicate that cellular effects of defensin 5 involve interactions with the extra-cellular domain of tumor necrosis Factor 1.
24198413 HD5 neutralizes JC polyomavirus infection by stabilizing the viral capsid and disrupting virus trafficking.
24165598 human alpha defensin 5 increases LGR stem cell migration into wound beds, leading to enhanced healing, bacterial reduction, and hair production through the augmentation of key Wnt and wound healing transcripts.
24086683 Anti-HIV activity of human defensin 5 in primary CD4+ T cells under serum-deprived conditions is a consequence of defensin-mediated cytotoxicity.
23958301 E-cadherin expression in squamous cells is reduced by HD-5
23841778 This study considers the redox properties of HD-5 and reports that the reduced form, HD-5 red, is a zinc-ion chelator.
23620768 Subnanometer resolution cryo-electron microscopy structures of HD5 complexed with both neutralization-sensitive and -resistant human adenovirus chimeras, were determined.
23269786 study demonstrate that binding of integrin alphavbeta5 and alpha defensin 5 have opposite effects on the elastic response of adenovirus type 35, revealing a direct link between virus-host interactions and the mechanical properties of the capsid
23028850 Human alpha-defensin-5 binds to both HIV-1 gp120 and CD4 and blocks the interaction of CD4 with gp120, which leads to inhibit HIV-1 replication in human primary CD4+ T lymphocytes
22573326 structural analysis of human enteric alpha-defensin HD5 shows a crucial role for hydrophobicity at the dimer interface
22354633 Several arginine residues and tyrosine 27 are important for HD-5 antibacterial activity.
21873175 The hydrophobicity of regions 2, 9 & 10 was higher than in other regions. It was difficult for the HD molecule to have many conformations because of its 3 S-S bridges; however, it responds to various external factors by restricting conformation.
21734566 Human alpha-defensin-5 binds to both HIV-1 gp120 and CD4 and blocks the interaction of CD4 with gp120, which leads to inhibit HIV-1 replication in human primary CD4+ T lymphocytes
21672195 Defensins 5 and 6 enhance HIV-1 infectivity through promoting HIV attachment.
21125297 Statistical analysis of gene expression showed a distinction between regions 1 and 2 of the small intestin for HD5.
20819643 To respond to LPS stimulation, human primary endocervical epithelial cells may function in the mucosal immune defense through TLR4 activation and HD5 secretion.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20629326 HalphaD-5 and HbetaD-2 may protect fallopian tubes during microbial infection.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20375624 This study demonstrated the multifunctional roles of the activation process in human defensin-5.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20130047 The authors provide direct evidence that human alpha-defensins block adenovirus infection by preventing uncoating during cell entry.
19855381 Data show that DEFA5-expressing mice had striking losses of segmented filamentous bacteria and fewer interleukin 17 (IL-17)-producing lamina propria T cells.
19640840 HNP1 and HD5 kill E. coli by a process that is mechanistically distinct from their actions that kill S. aureus; and chiral molecular recognition is not a stringent prerequisite for other functions of the defensins
19589339 Results report on the antibacterial properties and cellular interaction of Human Defensin 5 as a function of its positive charge and hydrophobicity.
19542459 Self-association and multivalent binding may play integral roles in the ability of alpha-defensin 5 (HD5) to protect against infections caused by viruses and other infectious agents.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19250512 Human enteric defensin (HD)-5 and HD-6 were detected in Paneth cells, which are observed in the gastric metaplastic mucosa as well as small intestinal epithelia. Less H. pylori was observed in the intestinal metaplasia with HD-5 expressing Paneth cells.
19194307 Observational study of gene-disease association. (HuGE Navigator)
19135873 Observational study of gene-disease association. (HuGE Navigator)
19080508 The concentrations of human defensin 5, HBD1, and HBD2 in vulvovaginal candidiasis patients were higher than in controls.
18782756 alpha-defensin human neutrophil protein 1 (HNP1) and human alpha-defensin 5 (HD5) inhibit BKV infection by targeting an early event in the viral lifecycle.
18635180 HBD-2 and HD-5 may be involved in defending against invasion by BV-related microorganisms and the decrease in IL-4 concentration may increase susceptibility to bacterial vaginosis
18499668 the primary function of the conserved salt bridge in HD5 is to ensure correct processing of proHD5 and subsequent stabilization of mature alpha-defensin in vivo
18435932 Clostridium difficile toxin B interacts with high affinity with HD5 which may provide a defense mechanism against clostridial glucosylating cytotoxins.
18394979 Single nucleotide polymorphism in defensin alpha 5 Paneth cell associated with inflammatory bowel diseases in caucasoid population.
18394979 Observational study of gene-disease association. (HuGE Navigator)
18258845 The persistence of HD5-chymotrypsinogen-trypsin complex in Crohn disease may be attributable to increased luminal levels of proteinase inhibitors such as alpha1-anti-trypsin.
18191790 We have found that the alpha-defensins HNP1 and HD5 have potent antiadenoviral activity. These molecules block HAdV infection by stabilizing the virus capsid, thereby preventing uncoating and virus-mediated endosome penetration.
17250830 HD-5 binds to the cell membrane of intestinal epithelial cells and induces secretion of the chemokine interleukin (IL)-8
17132727 Human alpha-defensin-5 binds to both HIV-1 gp120 and CD4 and blocks the interaction of CD4 with gp120, which leads to inhibit HIV-1 replication in human primary CD4+ T lymphocytes
17088326 Crystal structure of HD-5.
15616305 DEFA5 displays antimicrobial activity against E. coli, E. aerogenes, B. cereus, and S. aureus.
12660734 Defensin 5 transgenic mice were resistant to oral challenge with virulent Salmonella typhimurium; support for a critical in vivo role of epithelial-derived defensins in mammalian host defence
12021776 By acting as a prodefensin convertase in human Paneth cells, trypsin is involved in the regulation of innate immunity in the small intestine.

AA Sequence

MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTG      1 - 70
RCATRESLSGVCEISGRLYRLCCR                                                   71 - 94
//

Text Mined References (61)

PMID Year Title
26206286 2015 Antimicrobial activity of human ?-defensin 5 and its linear analogs: N-terminal fatty acylation results in enhanced antimicrobial activity of the linear analogs.
25970658 2015 Conformational landscape and pathway of disulfide bond reduction of human alpha defensin.
25664683 2015 Visualizing attack of Escherichia coli by the antimicrobial peptide human defensin 5.
25540379 2015 Alpha-defensin HD5 inhibits furin cleavage of human papillomavirus 16 L2 to block infection.
25517613 2014 Human defensins facilitate local unfolding of thermodynamically unstable regions of bacterial protein toxins.
25433720 2015 Regulation of human enteric ?-defensins by NOD2 in the Paneth cell lineage.
25430675 2014 A bacterial mutant library as a tool to study the attack of a defensin peptide.
25196670 2014 Altered ?-defensin 5 expression in cervical squamocolumnar junction: implication in the formation of a viral/tumour-permissive microenvironment.
24681099 2014 Functional intersection of Human Defensin 5 with the TNF receptor pathway.
24198413 2014 The human alpha defensin HD5 neutralizes JC polyomavirus infection by reducing endoplasmic reticulum traffic and stabilizing the viral capsid.
24165598 2013 Stimulation of the follicular bulge LGR5+ and LGR6+ stem cells with the gut-derived human alpha defensin 5 results in decreased bacterial presence, enhanced wound healing, and hair growth from tissues devoid of adnexal structures.
24086683 2013 Anti-HIV activity of human defensin 5 in primary CD4+ T cells under serum-deprived conditions is a consequence of defensin-mediated cytotoxicity.
23958301 2013 Reduction of E-cadherin by human defensin-5 in esophageal squamous cells.
23841778 2013 Reduction of human defensin 5 affords a high-affinity zinc-chelating peptide.
23620768 2013 An intrinsically disordered region of the adenovirus capsid is implicated in neutralization by human alpha defensin 5.
23269786 2013 Integrin and defensin modulate the mechanical properties of adenovirus.
22573326 2012 Functional determinants of human enteric ?-defensin HD5: crucial role for hydrophobicity at dimer interface.
22354633 2012 Expression and structure/function relationships of human defensin 5.
21873175 2011 Efficiency of antimicrobial defense: molecular flexibility of natural defensin and artificial bis-quaternary ammonium compound.
21672195 2011 Human defensins 5 and 6 enhance HIV-1 infectivity through promoting HIV attachment.
21125297 2011 Longitudinal cell formation in the entire human small intestine is correlated with the localization of Hath1 and Klf4.
20819643 2010 Role of Toll-like receptor 4 and human defensin 5 in primary endocervical epithelial cells.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20629326 2010 [The relationship between HalphaD-5 and HbetaD-2 in infertile women's fimbriae tubes with adhesions and atresias].
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20375624 2010 Precursor processing of human defensin-5 is essential to the multiple functions in vitro and in vivo.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20130047 2010 Direct evidence from single-cell analysis that human {alpha}-defensins block adenovirus uncoating to neutralize infection.
19855381 2010 Enteric defensins are essential regulators of intestinal microbial ecology.
19640840 2009 Through the looking glass, mechanistic insights from enantiomeric human defensins.
19589339 2009 Selective arginines are important for the antibacterial activity and host cell interaction of human alpha-defensin 5.
19542459 2009 Multivalent binding of carbohydrates by the human alpha-defensin, HD5.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19250512 2008 Functional role of metaplastic paneth cell defensins in Helicobacter pylori-infected stomach.
19194307 2009 Copy number variation of defensin genes and HIV infection in Brazilian children.
19135873 2009 Single nucleotide polymorphisms and the haplotype in the DEFB1 gene are associated with atopic dermatitis in a Korean population.
19080508 2008 [Study on vaginal production of human defensins and the correlated pathogenetic factors of vulvovaginal candidiasis].
18782756 2008 Human alpha-defensins inhibit BK virus infection by aggregating virions and blocking binding to host cells.
18635180 2008 Human defensins and cytokines in vaginal lavage fluid of women with bacterial vaginosis.
18499668 2008 The conserved salt bridge in human alpha-defensin 5 is required for its precursor processing and proteolytic stability.
18435932 2008 Human alpha-defensins inhibit Clostridium difficile toxin B.
18394979 2008 Single nucleotide polymorphisms in human Paneth cell defensin A5 may confer susceptibility to inflammatory bowel disease in a New Zealand Caucasian population.
18258845 2008 Impaired luminal processing of human defensin-5 in Crohn's disease: persistence in a complex with chymotrypsinogen and trypsin.
18191790 2008 Mechanism of adenovirus neutralization by Human alpha-defensins.
17250830 2007 Structure-dependent functional properties of human defensin 5.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17088326 2006 Crystal structures of human alpha-defensins HNP4, HD5, and HD6.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16341674 2005 Transcriptome analysis of human gastric cancer.
15616305 2005 Antibacterial activity and specificity of the six human {alpha}-defensins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12660734 2003 Protection against enteric salmonellosis in transgenic mice expressing a human intestinal defensin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12021776 2002 Paneth cell trypsin is the processing enzyme for human defensin-5.
9588893 1998 Gene expression, immunolocalization, and secretion of human defensin-5 in human female reproductive tract.
9169779 1997 Localization of human intestinal defensin 5 in Paneth cell granules.
8808285 1996 Human enteric defensin genes: chromosomal map position and a model for possible evolutionary relationships.
8626737 1996 Human enteric defensins. Gene structure and developmental expression.
1429669 1992 Paneth cells of the human small intestine express an antimicrobial peptide gene.