Property Summary

NCBI Gene PubMed Count 62
PubMed Score 83.97
PubTator Score 83.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Acute Promyelocytic Leukemia 32
Disease Target Count P-value
psoriasis 6685 2.8e-02
Disease Target Count Z-score Confidence
West Nile fever 6 3.451 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 2.8e-02

Gene RIF (45)

PMID Text
25300997 The expression of alpha-defensins 1, 2 and 3 is up-regulated in hypercholesteremia.
25083086 Elevated DEFA3 levels in diabetes are independent of DEFA3 copy numbers.
23050799 Results indicate that the gene expression of DEFA 1/3 and 4 was significantly increased in all tumours - except for a significant decrease of DEFA 4 gene expression in pleomorphic adenomas.
23011762 This study suggests that HNPs 1-3 promote tumor invasion and are potential indicators of disease progression in patients with bladder cancer.
22861387 A decrease in salivary HNP 1-3 levels might be a biological factor for predisposition to oral ulcers in patients with Behcet disease and oral infection in healthy patients.
22737966 alpha-Defensin (DEFA3)was the third most differentially overexpressed gene and may be related to the onset of Bell's palsy and Ramsay Hunt Syndrome.
22297599 expressional level of HNPs 1,2 and 3 were significantly higher and their distributions overlapped in cancerous tissues of gastric cancer patients
21861873 Directly isolated dendritic cells secrete alpha-defensins 1-3; E2 inhibits this secretion. Same trend is observed in myeloid dendritic cells isolated from pregnant women in their first trimester (low plasma E2) and third trimester (high plasma E2).
21831449 Increased levels of human neutrophil peptides 1, 2, and 3 in peritoneal fluid of patients with endometriosis: association with neutrophils, T cells and IL-8.
21333105 HNP1-3 concentrations in patients with multidrug-resistant tuberculosis were significantly lower than in drug-susceptible pulmonary TB and healthy controls
21187770 Changes in the expression pattern of DEFA 1/3 seem to be involved in the development of gingival irritation fibromas, whereas chronic inflammation might be of less importance.
20880148 alpha-defensins 1-3 in T cells from patients with SJS/TEN may be involved in the etiopathology of these life-threatening diseases induced by medications.
20502117 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20424487 Our report of DEFA1-3 expression by human omental adipocytes adds to the role of adipocytes in the primary defense against bacterial infection.
20406964 Observational study of gene-disease association. (HuGE Navigator)
20195543 Data show that high production of alpha-defensins1-3 by immature DCs appears as a host protective factor against progression of HIV-1 infection, suggesting potential diagnostic, therapeutic and preventive implications.
20151808 The total amount of gingival crevicular fluid human neutrophil peptide 3 were not different among periodontitis, gingivitis, and health control groups; there was no correlation with clinical periodontal parameters.
19864642 A population of immature dysplastic granulocytes contributes to the chronic myelomonocytic leukemia phenotype through production of alpha-defensins HNP1-3 that suppress the differentiation capabilities of monocytes.
19758174 Studies indicate alpha-defensin, the products of neutrophils wase upregulated at the mRNA and protein levels in SLE patients.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19363140 DEFA3 was upregulated in IPF patients with acute exacerbation
19263072 Salivary HNP-3concentrations increased following exercise
19194307 Observational study of gene-disease association. (HuGE Navigator)
18957723 Upregulation of HNP3 is associated with colorectal adenomas and carcinomas.
18757648 In African Americans, midpregnancy human neutrophil peptide 1-3 levels were more informative to preterm delivery risk than was bacterial vaginosis
18474654 The authors analyzed the sensitivities of different pneumococcal strains to HNP1-3 and found that encapsulated strains are efficiently killed at physiological concentrations (7.5 microg/ml).
18472248 There are increased levels of human neutrophil alpha-defensins (alpha-defensin-1, -2, and -3) in chronic venous leg ulcers.
18435932 Clostridium difficile toxin B interacts with high affinity with HNP-3 which may provide a defense mechanism against clostridial glucosylating cytotoxins.
18154640 Observational study of gene-disease association. (HuGE Navigator)
18003664 Serum alpha-defensin (-1, -2 and -3) concentrations are increased in type 1 diabetic patients with diabetic nephropathy.
17845323 Plasma levels of alpha-defensins 1-3 are an indicator of neutrophil activation in pregnant and post-partum women.
17531545 Alpha-defensins 1-3 levels are nonspecifically elevated in stools from patients with colorectal neoplasia and likely originate from white blood cells. Alpha-defensins 1-3 in stool might serve as markers of inflammatory bowel conditions.
17214878 We have tested the DEFA3 absence in 697 samples from different human populations. The proportion of subjects lacking DEFA3 varies from 10% to 37%, depending on the population tested, suggesting differences in innate immune function between populations.
17132727 Alpha-defensins inhibit the binding of HIV-1 gp120 to CD4 through interaction with the D1 domain of CD4
16837860 data suggest that alpha-defensins within lymphoid tissue are expressed by granulocytes and are prevalent in HIV-1-seronegative individuals with inflammatory processes as well as HIV-1-infected individuals
16700921 Subjects were genotyped for alpha-defensin-1/alpha-defensin-3, and four beta-defensin-1 polymorphisms. These polymorphisms may not be important in abnormally rapid lung function decline or susceptibility to lower respiratory infections.
15944200 expression levels in human white blood cells showed clear correlation between relative proportions of DEFA1:DEFA3 mRNA and corresponding gene numbers. However, there was no relationship between total (DEFA1+DEFA3) mRNA levels and total gene copy number
15620707 Alpha-defensins inhibit the binding of HIV-1 gp120 to CD4 through interaction with the D1 domain of CD4
15208269 HNP-3 is a potentially important regulator of neovascularizaiton, suggesting a new link between inflammation and angiogenesis.
15004048 Aerobic bacteria were 100% susceptible to HBD-2 and HBD-3, whereas only 21.4 and 50% of the anaerobes were susceptible to HBD-2 and HBD-3.
12913926 BPI and HNP 1-3 are accumulated in the synovial cavity of patients with rheumatoid arthritis
12871849 These results indicate that neutrophil defensins HNP-1, -2, and -3 increase epithelial wound repair in vitro, which involves migration and proliferation, mucin production, epidermal growth factor receptor activation and downstream signaling pathways.
12710851 increased levels in fetal disease, premature rupture of membranes, and preterm labor
2997278 DEFA3 encodes an antibacterial peptide that is bacteriocidal against S. aureus, E. coli, and P. aeruginosa.

AA Sequence

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRI      1 - 70
PACIAGERRYGTCIYQGRLWAFCC                                                   71 - 94
//

Text Mined References (64)

PMID Year Title
25300997 2014 Upregulated expression of human alpha-defensins 1, 2 and 3 in hypercholesteremia and its relationship with serum lipid levels.
25083086 2014 Relevance of ?-defensins (HNP1-3) and defensin ?-1 in diabetes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23050799 2012 Human ?-defensin (DEFA) gene expression helps to characterise benign and malignant salivary gland tumours.
23011762 2013 Plasma human neutrophil proteins-1, -2, and -3 levels in patients with bladder cancer.
22861387 2013 Salivary levels of HNP 1-3 are related to oral ulcer activity in Behçet's disease.
22737966 2012 Alpha-defensin overexpression in patients with Bell's palsy and Ramsay Hunt syndrome.
22297599 2012 Human neutrophil peptides 1-3 as gastric cancer tissue markers measured by MALDI-imaging mass spectrometry: implications for infiltrated neutrophils as a tumor target.
21861873 2011 Alpha-defensins 1-3 release by dendritic cells is reduced by estrogen.
21831449 2011 Increased levels of human neutrophil peptides 1, 2, and 3 in peritoneal fluid of patients with endometriosis: association with neutrophils, T cells and IL-8.
21333105 2011 Multidrug-resistant tuberculosis is associated with low plasma concentrations of human neutrophil peptides 1-3.
21187770 2011 High ?-defensin and S100A7 expression and missing DOC-1 down-regulation characterize irritation fibromas of the oral cavity and may counteract malignant transformation.
20880148 2011 Expression of ?-defensin 1-3 in T cells from severe cutaneous drug-induced hypersensitivity reactions.
20502117 2010 Increased genomic copy number of DEFA1/DEFA3 is associated with susceptibility to severe sepsis in Chinese Han population.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20424487 2010 The putative role of human peritoneal adipocytes in the fight against bacteria: synthesis of the antimicrobial active peptide DEFA1-3.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20195543 2010 Increased alpha-defensins 1-3 production by dendritic cells in HIV-infected individuals is associated with slower disease progression.
20151808 2010 Evaluation of gingival crevicular fluid adrenomedullin and human neutrophil peptide 1-3 levels of patients with different periodontal diseases.
19864642 2010 Alpha-defensins secreted by dysplastic granulocytes inhibit the differentiation of monocytes in chronic myelomonocytic leukemia.
19758174 2009 Defensins in systemic lupus erythematosus.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19363140 2009 Gene expression profiles of acute exacerbations of idiopathic pulmonary fibrosis.
19263072 2009 Salivary antimicrobial peptides (LL-37 and alpha-defensins HNP1-3), antimicrobial and IgA responses to prolonged exercise.
19194307 2009 Copy number variation of defensin genes and HIV infection in Brazilian children.
18957723 2008 Human Neutrophil Peptides 1-3--early markers in development of colorectal adenomas and carcinomas.
18757648 2008 Midpregnancy vaginal fluid defensins, bacterial vaginosis, and risk of preterm delivery.
18474654 2008 The capsule sensitizes Streptococcus pneumoniae to alpha-defensins human neutrophil proteins 1 to 3.
18472248 2008 Increased levels of human neutrophil alpha-defensins in chronic venous leg ulcers.
18435932 2008 Human alpha-defensins inhibit Clostridium difficile toxin B.
18154640 2007 MRPS18CP2 alleles and DEFA3 absence as putative chromosome 8p23.1 modifiers of hearing loss due to mtDNA mutation A1555G in the 12S rRNA gene.
18003664 2008 Increased levels of alpha-defensin (-1, -2 and -3) in type 1 diabetic patients with nephropathy.
17845323 2007 Plasma levels of alpha-defensins 1-3 are an indicator of neutrophil activation in pregnant and post-partum women.
17531545 2007 Detection of colorectal disease by stool defensin assay: an exploratory study.
17452329 2007 Toward understanding the cationicity of defensins. Arg and Lys versus their noncoded analogs.
17214878 2007 Inter-population variability of DEFA3 gene absence: correlation with haplotype structure and population variability.
16837860 2006 alpha-Defensins 1, 2, and 3 are expressed by granulocytes in lymphoid tissues of HIV-1-seropositive and -seronegative individuals.
16700921 2006 Contribution of alpha- and beta-defensins to lung function decline and infection in smokers: an association study.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15944200 2005 Copy number polymorphism and expression level variation of the human alpha-defensin genes DEFA1 and DEFA3.
15894545 2005 Reconstruction of the conserved beta-bulge in mammalian defensins using D-amino acids.
15616305 2005 Antibacterial activity and specificity of the six human {alpha}-defensins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15208269 2004 Regulation of neovascularization by human neutrophil peptides (alpha-defensins): a link between inflammation and angiogenesis.
15004048 2004 Human beta-defensins 2 and 3 demonstrate strain-selective activity against oral microorganisms.
12913926 2003 Intraarticular release and accumulation of defensins and bactericidal/permeability-increasing protein in patients with rheumatoid arthritis.
12871849 2004 Neutrophil defensins enhance lung epithelial wound closure and mucin gene expression in vitro.
12860195 2003 Antimicrobial peptides in the first line defence of human colon mucosa.
12710851 2003 Antimicrobial peptides in amniotic fluid: defensins, calprotectin and bacterial/permeability-increasing protein in patients with microbial invasion of the amniotic cavity, intra-amniotic inflammation, preterm labor and premature rupture of membranes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12375270 2002 Antimicrobial peptides are expressed and produced in healthy and inflamed human synovial membranes.
10914484 2000 Human neutrophil defensins selectively chemoattract naive T and immature dendritic cells.
8530462 1995 Inheritance of unequal numbers of the genes encoding the human neutrophil defensins HP-1 and HP-3.
8477861 1993 The structure of neutrophil defensin genes.
8476558 1993 Defensins: antimicrobial and cytotoxic peptides of mammalian cells.
8325384 1993 The structure of neutrophil defensin genes.
8080882 1994 Localization of human neutrophil peptide (HNP) and its messenger RNA in neutrophil series.
4056036 1985 Primary structures of three human neutrophil defensins.
3174637 1988 Isolation and characterization of human defensin cDNA clones.
2997278 1985 Defensins. Natural peptide antibiotics of human neutrophils.
2918759 1989 Differentiation stage-specific expression of a gene during granulopoiesis.
2917986 1989 Determination of the disulfide array in the human defensin HNP-2. A covalently cyclized peptide.
2006422 1991 Crystal structure of defensin HNP-3, an amphiphilic dimer: mechanisms of membrane permeabilization.
1339298 1992 Posttranslational processing of defensins in immature human myeloid cells.