Property Summary

NCBI Gene PubMed Count 64
PubMed Score 93.12
PubTator Score 83.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Leukemia, Promyelocytic, Acute 36 0.0 0.0
Disease Target Count
Acute Promyelocytic Leukemia 40
Disease Target Count P-value
psoriasis 6694 2.8e-02
Disease Target Count Z-score Confidence
West Nile fever 7 3.339 1.7
Dermatomycosis 2 3.134 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 2.8e-02

Gene RIF (47)

AA Sequence

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRI      1 - 70
PACIAGERRYGTCIYQGRLWAFCC                                                   71 - 94
//

Text Mined References (66)

PMID Year Title