Property Summary

NCBI Gene PubMed Count 29
PubMed Score 35.07
PubTator Score 3.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
West Nile fever 6 3.656 1.8
Mite infestation 2 3.065 1.5

Expression

Gene RIF (3)

PMID Text
25517613 binding of HNP1 to affected bacterial toxins caused their local unfolding, potentiated their thermal melting and precipitation, exposed new regions for proteolysis, and increased susceptibility to collisional quenchers.
19169650 Data show that H. pylori induces alpha-defensin release from granulocytes, which may be important in local host response to H. pylori infection in gastroduodenal diseases.
2997278 DEFA1B encodes an antibacterial peptide that is bacteriocidal against S. aureus, E. coli, and P. aeruginosa.

AA Sequence

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRI      1 - 70
PACIAGERRYGTCIYQGRLWAFCC                                                   71 - 94
//

Text Mined References (31)

PMID Year Title
25517613 2014 Human defensins facilitate local unfolding of thermodynamically unstable regions of bacterial protein toxins.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21904558 2011 Structural and Functional Consequences Induced by Post-Translational Modifications in ?-Defensins.
21861873 2011 Alpha-defensins 1-3 release by dendritic cells is reduced by estrogen.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19169650 2009 Helicobacter pylori induces the release of alpha-defensin by human granulocytes.
18083107 2007 Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.
17452329 2007 Toward understanding the cationicity of defensins. Arg and Lys versus their noncoded analogs.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15944200 2005 Copy number polymorphism and expression level variation of the human alpha-defensin genes DEFA1 and DEFA3.
15616305 2005 Antibacterial activity and specificity of the six human {alpha}-defensins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12860195 2003 Antimicrobial peptides in the first line defence of human colon mucosa.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10914484 2000 Human neutrophil defensins selectively chemoattract naive T and immature dendritic cells.
8530462 1995 Inheritance of unequal numbers of the genes encoding the human neutrophil defensins HP-1 and HP-3.
8477861 1993 The structure of neutrophil defensin genes.
8325384 1993 The structure of neutrophil defensin genes.
4056036 1985 Primary structures of three human neutrophil defensins.
3370315 1988 A myeloid-related sequence that localizes to human chromosome 8q21.1-22.
3174637 1988 Isolation and characterization of human defensin cDNA clones.
2997278 1985 Defensins. Natural peptide antibiotics of human neutrophils.
2918759 1989 Differentiation stage-specific expression of a gene during granulopoiesis.
2917986 1989 Determination of the disulfide array in the human defensin HNP-2. A covalently cyclized peptide.
2019582 1991 The isolation and identification of multiple forms of the neutrophil granule peptides from human leukemic cells.
1445873 1992 NMR studies of defensin antimicrobial peptides. 2. Three-dimensional structures of rabbit NP-2 and human HNP-1.
1445872 1992 NMR studies of defensin antimicrobial peptides. 1. Resonance assignment and secondary structure determination of rabbit NP-2 and human HNP-1.
1339298 1992 Posttranslational processing of defensins in immature human myeloid cells.