Property Summary

NCBI Gene PubMed Count 32
PubMed Score 37.38
PubTator Score 3.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
West Nile fever 7 3.577 1.8
Mite infestation 3 3.019 1.5

Expression

 HCA RNA Cell Line (3)

Protein-protein Interaction (1)

PDB (18)

Gene RIF (3)

AA Sequence

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRI      1 - 70
PACIAGERRYGTCIYQGRLWAFCC                                                   71 - 94
//

Text Mined References (35)

PMID Year Title