Property Summary

NCBI Gene PubMed Count 12
PubMed Score 22.25
PubTator Score 4.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2716 5.3e-11
ovarian cancer 8520 7.4e-08
psoriasis 6694 5.5e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Excessive tearing 12 3.787 1.9
Dacryocystitis 11 3.758 1.9
Zellweger syndrome 37 3.2 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.600 5.3e-11
ovarian cancer -1.300 7.4e-08
psoriasis 1.900 5.5e-05

AA Sequence

MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAAR      1 - 70
KLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSG     71 - 140
TFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGP    141 - 210
ISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVK    211 - 280
GLPDFASFSAKL                                                              281 - 292
//

Text Mined References (17)

PMID Year Title