Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.20
PubTator Score 253.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Esophageal Neoplasms 68 0.0 0.0
Disease Target Count Z-score Confidence
Acquired metabolic disease 329 0.0 1.4
pancreatic cancer 2322 0.0 1.4
Disease Target Count Z-score Confidence
Oropharynx cancer 9 3.054 1.5
Disease Target Count
Malignant tumor of esophagus 4

Expression

Gene RIF (10)

AA Sequence

MTMNVLEAGKWKSIVPAPGEGLLAVLHMMVFTDALHRERSVKWQAGVCYNGGKDFAVSLARPKAAEGIAD      1 - 70
//

Text Mined References (17)

PMID Year Title