Property Summary

NCBI Gene PubMed Count 64
PubMed Score 57.78
PubTator Score 43.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Rheumatoid Arthritis 1170
Disease Target Count P-value
osteosarcoma 7933 2.4e-09
psoriasis 6685 6.6e-05
medulloblastoma, large-cell 6234 1.8e-03
Polycystic Ovary Syndrome 334 4.7e-03
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 2 19 3.444 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -3.100 6.6e-05
osteosarcoma -1.715 2.4e-09
medulloblastoma, large-cell -1.300 1.8e-03
Polycystic Ovary Syndrome 1.337 4.7e-03

Gene RIF (38)

PMID Text
26783102 DDX6 may have a role in radio- and chemoresistance in glioblastoma
26610392 Functional analysis of the 11q23.3 glioma susceptibility locus implicates PHLDB1 and DDX6 in glioma susceptibility.
26412305 Results indicate that progenitor function is maintained by DDX6 complexes through two distinct pathways that include the degradation of differentiation-inducing transcripts and by promoting the translation of self-renewal and proliferation mRNAs.
26184334 Protein Interactome Analysis of DDX6
25995375 DDX6 repression complexes are required for P-body assembly.
25066606 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that DDX6 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with DDX6
25035296 CNOT1 facilitates recruitment of DDX6 to miRNA-targeted mRNAs, placing DDX6 as a downstream effector in the miRNA silencing pathway.
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that DDX6 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with DDX6
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that DDX6 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with DDX6
24768540 Crystal structure of the DDX6, CNOT9 and CNOT1 complex.
24768538 Crystal structures of the DDX6, CNOT1 and CNOT9 complexes.
24623418 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that DDX6 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with DDX6
24001599 study discovered multiple susceptibility variants for systemic lupus erythematosus in the 11q23.3 region, including variants in/near PHLDB1 (rs11603023), DDX6 (rs638893) and CXCR5 (rs10892301)
23932921 High DDX6 expression is associated with gastric cancer.
23926332 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that DDX6 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with DDX6
23826300 DDX6 and miR-122 modulate HCV through distinct pathways.
23535175 data indicate that P-body assembly occurs in a step-wise manner, where Rck participates in the initial suppression of mRNA translation, whereas Pat1b in a second step triggers P-body assembly and promotes mRNA decapping
23305486 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that DDX6 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with DDX6
23293030 DEAD-box RNA helicase 6 (DDX6) is a cellular modulator of vascular endothelial growth factor expression under hypoxia
22965301 We identified several unbalanced aberrations and a t(11;14) involving IGH and DDX6 providing evidence for a contribution of DDX6 to lymphomagenesis by deregulation of BCL6 in NMZL.
22851315 assembling HIV-1 co-opts a preexisting host complex containing cellular facilitators such as DDX6, which the virus uses to catalyze capsid assembly
22851315 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that DDX6 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with DDX6
22836354 Rck/p54 recruitment by sequence-specific translational repressors leads to further binding of Rck/p54 along mRNA molecules, resulting in their masking, unwinding, and ultimately recruitment to P-bodies.
22203041 RCK is a functional partner of TTP in promoting TTP-mediated translational repression of AU-rich mRNA
22190034 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that DDX6 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with DDX6
22022269 stud finds that DDX6 is required for efficient genome packaging of foamy virus, a spumaretrovirus
21957497 Data show that DDX6 is required for efficient assembly or release of infectious Dengue virus.
20884783 data suggest that in premature erythroid cells translational silencing of hr15-LOX mRNA is maintained by DDX6 mediated storage in these RNP granules
20392846 DDX6 helicase activity is essential for efficient hepatitis C virus replication, reflecting essential roles for DDX6 in hepatitis C virus genome amplification and/or maintenance of cellular homeostasis.
20158304 In the Australian GWAS, one SNP achieved genomewide significance for comorbid AD/ND, rs1784300 near DDX6 on chromosome 11 (p = 2.60 x 10(-9)).
19297524 The role of the p54 helicase activity in translational repression and in P-body formation, was examined.
19285948 Structural basis for the mutually exclusive anchoring of P body components EDC3 and Tral to the DEAD box protein DDX6/Me31B.
18769115 RCK/ p54 might be a determinant of colorectal cancer proliferation by activating the canonical Wnt pathway
18378046 DEAD-box helicase rck/p54, is involved in post-transcriptional regulation of APP, as its overexpression in cultured cells results in elevated levels of APP mRNA and protein
17392519 ataxin-2 interacts with the RNA helicase DDX6
16756390 Study shows that RCK/p54, a DEAD box helicase, interacts with Ago1 and Ago2, in active siRISC or miRISC from human cells; directly interacts with Ago1 and Ago2 in vivo, facilitates formation of P-bodies, and is a general repressor of translation.
16611246 The Over-expression of RCK-p54 protein in HeLa cells caused growth inhibition and cell cycle arrest at G2/M with down-regulation of c-myc expression.
12823589 Rck/p54 protein is possibly involved in the replication of HCV genomes in hepatocytes and in carcinogenesis of hepatocellular carcinoma.

AA Sequence

MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGD      1 - 70
DWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARA     71 - 140
KNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIM    141 - 210
RLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATF    211 - 280
PLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELL    281 - 350
AKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLH    351 - 420
RIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP           421 - 483
//

Text Mined References (69)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26783102 2016 Involvement of DDX6 gene in radio- and chemoresistance in glioblastoma.
26610392 2015 Functional analysis of the 11q23.3 glioma susceptibility locus implicates PHLDB1 and DDX6 in glioma susceptibility.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26412305 2015 DDX6 Orchestrates Mammalian Progenitor Function through the mRNA Degradation and Translation Pathways.
26184334 2015 Comprehensive Protein Interactome Analysis of a Key RNA Helicase: Detection of Novel Stress Granule Proteins.
26098573 2015 A conserved mechanism of TOR-dependent RCK-mediated mRNA degradation regulates autophagy.
25995375 2015 P-body assembly requires DDX6 repression complexes rather than decay or Ataxin2/2L complexes.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25035296 2014 Human DDX6 effects miRNA-mediated gene silencing via direct binding to CNOT1.
24862572 2014 Mammalian microtubule P-body dynamics are mediated by nesprin-1.
24768540 2014 A DDX6-CNOT1 complex and W-binding pockets in CNOT9 reveal direct links between miRNA target recognition and silencing.
24768538 2014 Structural and biochemical insights to the role of the CCR4-NOT complex and DDX6 ATPase in microRNA repression.
24001599 2014 Three SNPs in chromosome 11q23.3 are independently associated with systemic lupus erythematosus in Asians.
23932921 2013 DDX6 post-transcriptionally down-regulates miR-143/145 expression through host gene NCR143/145 in cancer cells.
23826300 2013 Modulation of hepatitis C virus RNA accumulation and translation by DDX6 and miR-122 are mediated by separate mechanisms.
23535175 2013 Role of Rck-Pat1b binding in assembly of processing-bodies.
23293030 2013 Identification of DEAD-box RNA helicase 6 (DDX6) as a cellular modulator of vascular endothelial growth factor expression under hypoxia.
23209657 2012 Ataxin-2-like is a regulator of stress granules and processing bodies.
22965301 2013 t(11;14)(q23;q32) involving IGH and DDX6 in nodal marginal zone lymphoma.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
22915799 2012 HIV-1 replication and APOBEC3 antiviral activity are not regulated by P bodies.
22851315 2012 HIV-1 Gag co-opts a cellular complex containing DDX6, a helicase that facilitates capsid assembly.
22836354 2012 Multiple binding of repressed mRNAs by the P-body protein Rck/p54.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22203041 2012 AU-rich-element-dependent translation repression requires the cooperation of tristetraprolin and RCK/P54.
22022269 2011 The DEAD-box RNA helicase DDX6 is required for efficient encapsidation of a retroviral genome.
21957497 Quantitative mass spectrometry of DENV-2 RNA-interacting proteins reveals that the DEAD-box RNA helicase DDX6 binds the DB1 and DB2 3' UTR structures.
21383967 2011 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.
21269460 2011 Initial characterization of the human central proteome.
20884783 2010 DDX6 recruits translational silenced human reticulocyte 15-lipoxygenase mRNA to RNP granules.
20826699 2010 Distinct functions of maternal and somatic Pat1 protein paralogs.
20616046 2010 LIM-domain proteins, LIMD1, Ajuba, and WTIP are required for microRNA-mediated gene silencing.
20584987 2010 Human Pat1b connects deadenylation with mRNA decapping and controls the assembly of processing bodies.
20543818 2010 The C-terminal alpha-alpha superhelix of Pat is required for mRNA decapping in metazoa.
20392846 2010 DDX6 (Rck/p54) is required for efficient hepatitis C virus replication but not for internal ribosome entry site-directed translation.
20158304 2010 A genomewide association study of nicotine and alcohol dependence in Australian and Dutch populations.
19946888 2010 Defining the membrane proteome of NK cells.
19297524 2009 Role of p54 RNA helicase activity and its C-terminal domain in translational repression, P-body localization and assembly.
19285948 2009 Structural basis for the mutually exclusive anchoring of P body components EDC3 and Tral to the DEAD box protein DDX6/Me31B.
18769115 2008 Knockdown of RCK/p54 expression by RNAi inhibits proliferation of human colorectal cancer cells in vitro and in vivo.
18378046 2009 Rck/p54 interacts with APP mRNA as part of a multi-protein complex and enhances APP mRNA and protein expression in neuronal cell lines.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17392519 2007 Ataxin-2 interacts with the DEAD/H-box RNA helicase DDX6 and interferes with P-bodies and stress granules.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16756390 2006 Translation repression in human cells by microRNA-induced gene silencing requires RCK/p54.
16699599 2006 Human retroviral host restriction factors APOBEC3G and APOBEC3F localize to mRNA processing bodies.
16611246 2006 Structural insight of human DEAD-box protein rck/p54 into its substrate recognition with conformational changes.
16364915 2005 Multiple processing body factors and the ARE binding protein TTP activate mRNA decapping.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684915 2004 Crystallization and X-ray analysis of the N-terminal core domain of a tumour-associated human DEAD-box RNA helicase, rck/p54.
12823589 2003 Overexpression of a DEAD box/RNA helicase protein, rck/p54, in human hepatocytes from patients with hepatitis C virus-related chronic hepatitis and its implication in hepatocellular carcinogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11839790 2002 RNA helicase p54 (DDX6) is a shuttling protein involved in nuclear assembly of stored mRNP particles.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10360675 1999 Overexpression of rck/p54, a DEAD box protein, in human colorectal tumours.
10319407 1999 Expression of two dead box genes (DDX1 and DDX6) is independent of that of MYCN in human neuroblastoma cell lines.
8816452 1996 Functional properties of p54, a novel SR protein active in constitutive and alternative splicing.
7614484 1995 The rck/p54 candidate proto-oncogene product is a 54-kilodalton D-E-A-D box protein differentially expressed in human and mouse tissues.
1579499 1992 Cloning, expression and localization of an RNA helicase gene from a human lymphoid cell line with chromosomal breakpoint 11q23.3.
1394235 1992 The RCK gene associated with t(11;14) translocation is distinct from the MLL/ALL-1 gene with t(4;11) and t(11;19) translocations.