Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Orofaciodigital syndrome 5 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 1.0
Disease Target Count Z-score Confidence
Orofaciodigital syndrome 21 5.884 2.9
Microcephaly 166 3.142 1.6
Disease Target Count
orofaciodigital syndrome V 1

Expression

  Differential Expression (8)

Disease log2 FC p
aldosterone-producing adenoma -1.067 1.6e-02
astrocytic glioma 1.500 5.3e-03
ependymoma 1.500 7.5e-03
group 3 medulloblastoma 1.700 3.2e-03
oligodendroglioma 1.400 4.7e-03
osteosarcoma -1.466 1.6e-08
ovarian cancer -1.100 6.6e-06
pancreatic ductal adenocarcinoma liver m... 1.661 1.1e-03

Gene RIF (3)

AA Sequence

MFVPRSLKIKRNANDDGKSCVAKIIKPDPEDLQLDKSRDVPVDAVATEAATIDRHISESCPFPSPGGQLA      1 - 70
EVHSVSPEQGAKDSHPSEEPVKSFSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVK     71 - 140
EKEEKSKLSNPQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTRPIIDFEHCSL    141 - 210
PEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMRALFESKTPSALILTPT    211 - 280
RELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLYRLQQHVKVIIATPGRLLDIIKQSSVELCGVKIV    281 - 350
VVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQI    351 - 420
ILWVEDPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKG    421 - 490
LLEGDYEVVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKRLFWDI    491 - 560
AKRVKPTGSILPPQLLNSPYLHDQKRKEQQKDKQTQNDLVTGANLMDIIRKHDKSNSQK               561 - 619
//

Text Mined References (19)

PMID Year Title