Property Summary

NCBI Gene PubMed Count 324
PubMed Score 922.09
PubTator Score 539.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
psoriasis 2.300 1.7e-08
adult high grade glioma 1.100 3.7e-04
Astrocytoma, Pilocytic 1.300 8.3e-06
Atopic dermatitis 1.100 1.5e-03
cutaneous lupus erythematosus 2.200 4.9e-04
cystic fibrosis 1.402 5.0e-05
dermatomyositis 1.500 2.1e-02
ependymoma 1.200 5.5e-05
glioblastoma 1.200 1.6e-04
hepatocellular carcinoma 1.200 8.3e-03
interstitial cystitis 1.100 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.700 1.4e-02
juvenile dermatomyositis 2.757 8.6e-13
lung cancer -2.200 2.4e-04
osteosarcoma -1.125 1.1e-02
ovarian cancer 1.300 7.4e-03
primary Sjogren syndrome 1.200 3.5e-03
Systemic lupus erythematosus 1.200 5.8e-03
tuberculosis 1.200 7.5e-03

Protein-protein Interaction (1)

PDB (21)

Gene RIF (291)

AA Sequence

MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWF      1 - 70
RGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEIL     71 - 140
QICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQ    141 - 210
IFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEH    211 - 280
HLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQI    281 - 350
LVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNT    351 - 420
DEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRIC    421 - 490
KDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARM    491 - 560
KDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETIT    561 - 630
ILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVA    631 - 700
DEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQT    701 - 770
WDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKE    771 - 840
CFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKD    841 - 910
FHFEKIPFDPAEMSK                                                           911 - 925
//

Text Mined References (337)

PMID Year Title