Property Summary

NCBI Gene PubMed Count 12
PubMed Score 18.02
PubTator Score 2.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (2)

AA Sequence

MDVHDLFRRLGAGAKFDTRRFSADAARFQIGKRKYDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQN      1 - 70
GEKKEESLTERKREQSKKKRKTMTSEIASQEEGATIQWMSSVEAKIEDKKVQRESKLTSGKLENLRKEKI     71 - 140
NFLRNKHKIHVQGTDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAP    141 - 210
TGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIHMIHKAAVAAKKFGP    211 - 280
KSSKKFDILVTTPNRLIYLLKQDPPGIDLASVEWLVVDESDKLFEDGKTGFRDQLASIFLACTSHKVRRA    281 - 350
MFSATFAYDVEQWCKLNLDNVISVSIGARNSAVETVEQELLFVGSETGKLLAMRELVKKGFNPPVLVFVQ    351 - 420
SIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFP    421 - 490
TSSVEYIHRIGRTGRAGNKGKAITFFTEDDKPLLRSVANVIQQAGCPVPEYIKGFQKLLSKQKKKMIKKP    491 - 560
LERESISTTPKCFLEKAKDKQKKVTGQNSKKKVALEDKS                                   561 - 599
//

Text Mined References (18)

PMID Year Title