Property Summary

NCBI Gene PubMed Count 106
PubMed Score 108.61
PubTator Score 103.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 2.5e-04
glioblastoma -1.400 2.8e-04
non-small cell lung cancer -1.318 1.3e-16
diabetes mellitus -1.600 5.2e-03
subependymal giant cell astrocytoma -1.271 8.9e-03
ovarian cancer -2.200 2.3e-07

Protein-protein Interaction (164)

U2SURP   POLR2D   DHX15   PRPF4   SART1   HNRNPR   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   PQBP1   PRPF40A   SF3B1   WBP4   SNRNP200   BCAS2   DNAJC8   SMNDC1   PRPF6   PCF11   CD2BP2   CPSF4   LSM8   SYF2   HNRNPC   SNRPB2   SNRNP70   SNRPA   SNRPC   HNRNPA1   SNRPA1   HSPA8   GTF2F2   SNRPB   HNRNPL   POLR2C   POLR2E   HNRNPA2B1   POLR2A   U2AF2   PTBP1   POLR2B   HNRNPH1   CSTF2   GTF2F1   FUS   POLR2I   RBMX   EIF4A3   BUD31   PAPOLA   HNRNPA3   HNRNPM   POLR2H   POLR2J   HNRNPF   RBM5   POLR2K   SNU13   HNRNPH2   POLR2F   MAGOH   HNRNPK   SNRPE   SNRPF   SNRPG   LSM3   LSM6   SNRPD1   SNRPD2   SNRPD3   POLR2G   POLR2L   TRA2B   SNURF   YBX1   TXNL4A   SRSF3   HNRNPU   U2AF1   SRSF2   CSTF1   SRSF11   SRSF1   SRSF4   DHX9   CPSF1   SF3A3   ELAVL2   CSTF3   HNRNPA0   SRSF9   SRSF5   SRSF6   SF3B2   SNW1   HNRNPD   EFTUD2   RNPS1   PCBP1   PCBP2   SF3B3   SF3B4   SF3A2   SF3A1   SF1   ELAVL1   SRSF7   USP39   PRPF8   FIP1L1   CWC27   DDX46   PHF5A   PABPN1   ALYREF   DDX42   CHERP   SUGP1   CCAR1   SRRM1   CPSF7   PRPF38A   U2AF1L4   SNRNP27   PRPF31   CTNNBL1   DHX38   PRCC   SYMPK   GPKOW   CLP1   MAGOHB   PPWD1   SNRNP40   RBM17   CDC5L   HNRNPUL1   DDX23   SF3B5   UPF3B   CRNKL1   WDR33   CSTF2T   CWC22   XAB2   RBM22   CWC25   CWC15   CPSF2   PUF60   LSM7   CPSF3   ISY1   PRPF19   SRRM2   WBP11   LSM2   LSM5   LSM4   RBM8A  

Gene RIF (67)

PMID Text
26739063 LMTK3 escapes tumour suppressor miRNAs via sequestration of DDX5.
26587974 p53 gain-of-function mutations accelerate endometrial carcinoma progression and metastasis by interfering with Drosha and p68 binding and pri-miR-26a-1 processing, resulting in reduced miR-26a expression and EZH2 overexpression.
26469385 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
26362536 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
26314252 Cervical cancer cell DDX5 gene is transcriptionally upregulated by calcitriol through a VDRE located in its proximal promoter.
26312911 siRNA knockdown of DDX5 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV-1 demonstrates decreased infectivity.
26212035 DDX5 played an important role in the proliferation and tumorigenesis of non-small-cell lung cancer cells by activating the beta-catenin signaling pathway.
26209609 Systematic Determination of Human Cyclin Dependent Kinase (CDK)-9 Interactome Identifies Novel Functions in RNA Splicing Mediated by the DEAD Box DDX5 and DDX17 RNA Helicases
26080402 study shows that correction of p68 may reduce toxicity of the mutant RNAs in DM1 and in DM2
26035968 DDX5 protein is essential for normal cell proliferation; (2) the transition from G1 to S/G2 phase is accompanied by an increase of DDX5 protein concentration in the cells.
25963660 Data indicate that cyclooxygenase 2 (COX-2) correlates inversely to microRNA 183 (miR-183) and directly to DEAD-box helicase p68 (DDX5).
25745998 Results show that a new mechanism of oncogenesis is attributed to p68 by upregulation of AKT and consequent nuclear exclusion and degradation of tumor suppressor FOXO3a.
25701821 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
25701821 siRNA knockdown of DDX5 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV-1 demonstrates decreased infectivity.
24910439 Downregulation of DDX5 and DDX17 protein expression during myogenesis and epithelial-to-mesenchymal transdifferentiation contributes to the switching of splicing programs during these processes.
24910429 AML is dependent on DDX5 and that inhibiting DDX5 expression slows AML cell proliferation.
24644279 Data indicate that armadillo repeat protein ARVCF interacts with the splicing factors the splicing factor SRSF1 (SF2/ASF), the RNA helicase p68 (DDX5), and the heterogeneous nuclear ribonucleoprotein hnRNP H2.
24626184 The data provide a model in which p68 and p53 interplay regulates PLK1 expression, and which describes the behavior of these molecules, and the outcome of their interaction, in human breast cancer.
24035833 In conclusion, authors identified DDX5 as a positive regulator for Japanese encephalitis virus replication via its binding to viral 3' UTR.
23874603 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
23741449 DDX5 facilitates HIV-1 replication as a cellular co-factor of Rev.
23741449 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
23741449 siRNA knockdown of DDX5 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV-1 demonstrates decreased infectivity.
23608157 Results suggest that distinct DDX DEAD-box RNA helicases DDX3 and DDX5 cooperate to modulate the HIV-1 Rev function.
23608157 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
23349811 Data show that p68/DdX5 immunoprecipitated with RNA polymerase II (RNAP II) and suggest p68 is important in facilitating beta-catenin and androgen receptor (AR) transcriptional activity in prostate cancer cells.
23322042 p68, in the presence of Ca-calmodulin, can function as a microtubule motor.
23125841 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
23108395 DDX5 might be critical for NOTCH1-mediated T-ALL pathogenesis and thus is a potential new target for modulating the Notch signaling in leukemia
23022728 RNA helicases Ddx17 and Ddx5 contribute to tumor-cell invasiveness by regulating alternative splicing of several DNA- and chromatin-binding factors, including the macroH2A1 histone.
22944692 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
22810421 High p68 RNA helicase expression is associated with glioma.
22750847 Results show a novel role for DDX5 in cancer cell proliferation and suggest DDX5 as a therapeutic target in breast cancer treatment.
22640416 there is a direct interaction between DDX5 and NS5B and DDX5 has two independent NS5B-binding sites
22476084 The DEAD box RNA helicase p68, also referred to as DDX5, directly interacts with VDR.
22266867 Data indicate that transcriptional coregulator ddx5/ddx17 RNA helicases can simultaneously regulate the transcriptional activity and alternative splicing of NFAT5 transcription factor.
22174317 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
22086602 High DDX5 is associated with basal breast cancer cells.
21343338 Using an RNA affinity pulldown-coupled mass spectrometry approach the study identified DDX5/RNA helicase p68 as an activator of TAU exon 10 splicing.
20966046 DEAD-box RNA helicase p68 (DDX5) and its associated noncoding RNA, steroid receptor RNA activator (SRA), form a complex with CTCF that is essential for insulator function
20818423 a striking inverse association of p68 and delta133p53 expression in primary breast cancers was identified.
20663877 Pleiotropic effects of p300-mediated acetylation on p68 and p72 RNA helicase.
20124720 crystallization and preliminary diffraction analysis of N-terminal region of DDX5 is reported.X-ray diffraction data were processed to a resolution of 2.7 A.
20022962 DDX5 is a repressor of fibrogenic genes in HSCs through interaction with transcriptional complexes.
19718048 Distinct but important roles for both p68 and p72 in regulating ERalpha activity in breast cancer.
19224332 the Ddx5 (Asp-Glu-Ala-Asp box polypeptide 5) protein showed specific interaction with SARS-CoV helicase.
19171422 Upregulated in at least 50% of multiple myeloma cases tested.
18829551 p68 is a novel AR transcriptional coactivator that is significantly overexpressed in PCa with a possible role in progression to hormone-refractory disease.
18794152 A ubiquitously expressed, androgen-insensitive gene, DDX5, fused in frame with ETV4, leading to the expression of a DDX5-ETV4 fusion protein was identified in prostate cancer.
18239468 DEAD-box RNA helicase p68 is not required for nuclear translocation of beta-catenin in colon cancer cells.
18005418 The DEAD-box proteins p68(Ddx5) and p72(Ddx17) were used as models for this coexpression frequency analysis as there are defined functions for these proteins in splicing and transcription.
17724023 P68 RNA helicase is an essential component of the let-7 microRNA pathway
17699760 p68/p72 may contribute to colon cancer formation by directly up-regulating proto-oncogenes and indirectly by down-regulating the growth suppressor p21(WAF1/CIP1).
17540040 The percentage correlation between Q-RT-PCR and microarray were 70% and 48% by using DDX5 and GAPDH as internal controls, respectively.
17384675 A mutant that carries mutations at the phosphorylation sites (Y593/595F) dramatically sensitizes TRAIL-resistant cells to TRAIL-induced apoptosis, suggesting a potential therapeutic strategy to overcome TRAIL resistance.
17369852 SUMO modification of the DEAD box protein p68 modulates its transcriptional activity and promotes its interaction with HDAC1
17018282 Data show that P68 RNA helicase mediates platelet-derived growth factor-induced epithelial mesenchymal transition by displacing Axin from beta-catenin.
16697732 Observational study of gene-disease association. (HuGE Navigator)
16697732 Patient with chronic hepatitis C carrying DDX5 haplotypes are at an increased risk of developing advanced liver fibrosis.
15950181 In addition, it could be demonstrated that increasing the Tlk1 activity in HT1080 cells by forced Tlk1 overexpression leads to an increased phosphorylation of endogenous p68.
15927448 data suggest that function(s) of p68 RNA helicase may be subjected to the regulation of multiple cell signal pathways
15660129 mechanism by which p68 may act as a tumour cosuppressor in governing p53 transcriptional activity
15304501 there is a tightly controlled expression and nucleolar localization of p68 in keratinocytes in vitro and during skin repair in vivo that functionally contributes to keratinocyte proliferation and gene expression
15298701 p68 is an important transcriptional regulator, functioning as a co-activator and/or co-repressor depending on the context of the promoter & the transcriptional complex. AA 1-478 of p68 can repress transcription as well as the full-length protein.
12665590 role in c-H-ras alternative splicing regulation
12527917 synergism with transcriptional coactivators CBP and p300
12101238 Essential for pre-mrna splicing in vitro; may function in destabilizing the U1-5'ss interaction. Depletion of p68 RNA helicase arrested spliceosome assembly at the prespliceosome stage

AA Sequence

MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTA      1 - 70
QEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQT     71 - 140
GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQ    141 - 210
IRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSA    211 - 280
TWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVET    281 - 350
KRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN    351 - 420
SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMK    421 - 490
DDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRT    491 - 560
GNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ                    561 - 614
//

Text Mined References (124)

PMID Year Title
26739063 2016 LMTK3 escapes tumour suppressor miRNAs via sequestration of DDX5.
26587974 2015 Mutant p53 induces EZH2 expression and promotes epithelial-mesenchymal transition by disrupting p68-Drosha complex assembly and attenuating miR-26a processing.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26314252 2015 The expression of RNA helicase DDX5 is transcriptionally upregulated by calcitriol through a vitamin D response element in the proximal promoter in SiHa cervical cells.
26212035 2015 DDX5 promotes proliferation and tumorigenesis of non-small-cell lung cancer cells by activating ?-catenin signaling pathway.
26209609 2015 Systematic Determination of Human Cyclin Dependent Kinase (CDK)-9 Interactome Identifies Novel Functions in RNA Splicing Mediated by the DEAD Box (DDX)-5/17 RNA Helicases.
26080402 2015 Reduction of toxic RNAs in myotonic dystrophies type 1 and type 2 by the RNA helicase p68/DDX5.
26035968 2015 [The DDX5 protein is involved in cell proliferation and differentiation].
25963660 2015 Regulation of MicroRNA 183 by Cyclooxygenase 2 in Liver Is DEAD-Box Helicase p68 (DDX5) Dependent: Role in Insulin Signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25745998 2015 The DEAD box protein p68: a crucial regulator of AKT/FOXO3a signaling axis in oncogenesis.
25604459 2015 Identification of cytoplasmic proteins interacting with unliganded estrogen receptor ? and ? in human breast cancer cells.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24910439 2014 RNA helicases DDX5 and DDX17 dynamically orchestrate transcription, miRNA, and splicing programs in cell differentiation.
24910429 2014 Acquired dependence of acute myeloid leukemia on the DEAD-box RNA helicase DDX5.
24644279 2014 Nuclear ARVCF protein binds splicing factors and contributes to the regulation of alternative splicing.
24626184 2014 The RNA helicase/transcriptional co-regulator, p68 (DDX5), stimulates expression of oncogenic protein kinase, Polo-like kinase-1 (PLK1), and is associated with elevated PLK1 levels in human breast cancers.
24581491 2014 Hippo signaling regulates microprocessor and links cell-density-dependent miRNA biogenesis to cancer.
24219989 2013 Acetylation of p53 stimulates miRNA processing and determines cell survival following genotoxic stress.
24035833 2013 The DEAD-box RNA helicase DDX5 acts as a positive regulator of Japanese encephalitis virus replication by binding to viral 3' UTR.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23741449 2013 DDX5 facilitates HIV-1 replication as a cellular co-factor of Rev.
23608157 2013 Distinct DDX DEAD-box RNA helicases cooperate to modulate the HIV-1 Rev function.
23349811 2013 p68/DdX5 supports ?-catenin & RNAP II during androgen receptor mediated transcription in prostate cancer.
23322042 2013 Interaction between p68 RNA helicase and Ca2+-calmodulin promotes cell migration and metastasis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23143267 2013 The RNA helicase DDX5/p68 is a key factor promoting c-fos expression at different levels from transcription to mRNA export.
23108395 2013 DDX5 is a positive regulator of oncogenic NOTCH1 signaling in T cell acute lymphoblastic leukemia.
23022728 2012 Splicing switch of an epigenetic regulator by RNA helicases promotes tumor-cell invasiveness.
22810421 2012 p68 RNA helicase promotes glioma cell proliferation in vitro and in vivo via direct regulation of NF-?B transcription factor p50.
22750847 2012 DDX5 regulates DNA replication and is required for cell proliferation in a subset of breast cancer cells.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22640416 2012 The variable N-terminal region of DDX5 contains structural elements and auto-inhibits its interaction with NS5B of hepatitis C virus.
22476084 2012 DDX5 is a multifunctional co-activator of steroid hormone receptors.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22266867 2012 Dual role of the ddx5/ddx17 RNA helicases in the control of the pro-migratory NFAT5 transcription factor.
22156369 2012 New function for the RNA helicase p68/DDX5 as a modifier of MBNL1 activity on expanded CUG repeats.
22086602 2012 RNA helicase DDX5 regulates microRNA expression and contributes to cytoskeletal reorganization in basal breast cancer cells.
21994455 2011 Generation and comprehensive analysis of an influenza virus polymerase cellular interaction network.
21911577 2011 A physical interaction network of dengue virus and human proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21343338 2011 RNA helicase p68 (DDX5) regulates tau exon 10 splicing by modulating a stem-loop structure at the 5' splice site.
21269460 2011 Initial characterization of the human central proteome.
21182205 2011 Identification of proteins associated with ligand-activated estrogen receptor ? in human breast cancer cell nuclei by tandem affinity purification and nano LC-MS/MS.
20966046 2010 Mediation of CTCF transcriptional insulation by DEAD-box RNA-binding protein p68 and steroid receptor RNA activator SRA.
20941364 2010 Comparative structural analysis of human DEAD-box RNA helicases.
20818423 2010 The RNA helicase p68 modulates expression and function of the ?133 isoform(s) of p53, and is inversely associated with ?133p53 expression in breast cancer.
20676135 2010 Phosphorylated p68 RNA helicase activates Snail1 transcription by promoting HDAC1 dissociation from the Snail1 promoter.
20663877 2010 Pleiotropic effects of p300-mediated acetylation on p68 and p72 RNA helicase.
20124720 2010 Expression, purification and preliminary crystallographic analysis of recombinant human DEAD-box polypeptide 5.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20022962 2010 A DDX5 S480A polymorphism is associated with increased transcription of fibrogenic genes in hepatic stellate cells.
19995069 2010 Sumoylation of p68 and p72 RNA helicases affects protein stability and transactivation potential.
19946888 2010 Defining the membrane proteome of NK cells.
19718048 2009 The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19224332 2009 Interaction between SARS-CoV helicase and a multifunctional cellular protein (Ddx5) revealed by yeast and mammalian cell two-hybrid systems.
19171422 2009 SAGE analysis highlights the importance of p53csv, ddx5, mapkapk2 and ranbp2 to multiple myeloma tumorigenesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18829551 2008 The RNA helicase p68 is a novel androgen receptor coactivator involved in splicing and is overexpressed in prostate cancer.
18809582 2008 Nucleophosmin serves as a rate-limiting nuclear export chaperone for the Mammalian ribosome.
18794152 2008 A fluorescence in situ hybridization screen for E26 transformation-specific aberrations: identification of DDX5-ETV4 fusion protein in prostate cancer.
18698352 2008 P68 RNA helicase (DDX5) alters activity of cis- and trans-acting factors of the alternative splicing of H-Ras.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18457437 2008 Identification of intracellular proteins associated with the EBV-encoded nuclear antigen 5 using an efficient TAP procedure and FT-ICR mass spectrometry.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
18239468 2008 DEAD-box RNA helicase p68 is not required for nuclear translocation of beta-catenin in colon cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18005418 2007 Identification of novel pathway partners of p68 and p72 RNA helicases through Oncomine meta-analysis.
17960593 2008 p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17724023 2007 P68 RNA helicase unwinds the human let-7 microRNA precursor duplex and is required for let-7-directed silencing of gene expression.
17699760 2007 Involvement of RNA helicases p68 and p72 in colon cancer.
17540040 2007 Selection of DDX5 as a novel internal control for Q-RT-PCR from microarray data using a block bootstrap re-sampling scheme.
17384675 2007 A double tyrosine phosphorylation of P68 RNA helicase confers resistance to TRAIL-induced apoptosis.
17369852 2007 SUMO modification of the DEAD box protein p68 modulates its transcriptional activity and promotes its interaction with HDAC1.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17018282 2006 P68 RNA helicase mediates PDGF-induced epithelial mesenchymal transition by displacing Axin from beta-catenin.
17011493 2006 The RNA helicases p68/p72 and the noncoding RNA SRA are coregulators of MyoD and skeletal muscle differentiation.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16697732 2006 Identification of two gene variants associated with risk of advanced fibrosis in patients with chronic hepatitis C.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15950181 2005 Identification of the human DEAD-box protein p68 as a substrate of Tlk1.
15927448 2005 Signaling to the DEAD box--regulation of DEAD-box p68 RNA helicase by protein phosphorylations.
15846844 2005 Proteomic profiling of cellular proteins interacting with the hepatitis C virus core protein.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15660129 2005 The DEAD box protein p68: a novel transcriptional coactivator of the p53 tumour suppressor.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15464984 2004 Functional interaction between Smad, CREB binding protein, and p68 RNA helicase.
15304501 2004 p68 DEAD box RNA helicase expression in keratinocytes. Regulation, nucleolar localization, and functional connection to proliferation and vascular endothelial growth factor gene expression.
15298701 2004 The p68 and p72 DEAD box RNA helicases interact with HDAC1 and repress transcription in a promoter-specific manner.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15113910 2004 Cellular RNA helicase p68 relocalization and interaction with the hepatitis C virus (HCV) NS5B protein and the potential role of p68 in HCV RNA replication.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12738788 2003 Full activation of estrogen receptor alpha activation function-1 induces proliferation of breast cancer cells.
12665590 2003 Roles of hnRNP A1, SR proteins, and p68 helicase in c-H-ras alternative splicing regulation.
12595555 2003 The highly related DEAD box RNA helicases p68 and p72 exist as heterodimers in cells.
12527917 2003 Synergism between p68 RNA helicase and the transcriptional coactivators CBP and p300.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11279182 2001 A-kinase-anchoring protein AKAP95 is targeted to the nuclear matrix and associates with p68 RNA helicase.
11250900 2001 A subfamily of RNA-binding DEAD-box proteins acts as an estrogen receptor alpha coactivator through the N-terminal activation domain (AF-1) with an RNA coactivator, SRA.
10837141 2000 The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase.
10648785 2000 Structure and expression of the human p68 RNA helicase gene.
10409727 1999 Purification and identification of p68 RNA helicase acting as a transcriptional coactivator specific for the activation function 1 of human estrogen receptor alpha.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7774924 1995 Construction of a transcription map surrounding the BRCA1 locus of human chromosome 17.
7525583 1994 Regulation of p68 RNA helicase by calmodulin and protein kinase C.
2762324 1989 Chromosome mapping of the human gene encoding the 68-kDa nuclear antigen (p68) by using the polymerase chain reaction.
2451786 1988 Nuclear protein with sequence homology to translation initiation factor eIF-4A.
2349099 1990 Complete cDNA sequence of the human p68 protein.
1996094 1991 p68 RNA helicase: identification of a nucleolar form and cloning of related genes containing a conserved intron in yeasts.