Property Summary

NCBI Gene PubMed Count 21
PubMed Score 102.51
PubTator Score 37.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
cystic fibrosis 1696 7.2e-08
colon cancer 1478 3.9e-03
group 3 medulloblastoma 4104 4.0e-03
lung cancer 4740 5.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Rheumatoid lung disease 1 3.803 1.9
Cancer 2499 3.135 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer 2.700 3.9e-03
cystic fibrosis 3.032 7.2e-08
group 3 medulloblastoma 1.900 4.0e-03
lung cancer -1.600 5.5e-03

Gene RIF (11)

AA Sequence

MSHHGGAPKASTWVVASRRSSTVSRAPERRPAEELNRTGPEGYSVGRGGRWRGTSRPPEAVAAGHEELPL      1 - 70
CFALKSHFVGAVIGRGGSKIKNIQSTTNTTIQIIQEQPESLVKIFGSKAMQTKAKAVIDNFVKKLEENYN     71 - 140
SECGIDTAFQPSVGKDGSTDNNVVAGDRPLIDWDQIREEGLKWQKTKWADLPPIKKNFYKESTATSAMSK    141 - 210
VEADSWRKENFNITWDDLKDGEKRPIPNPTCTFDDAFQCYPEVMENIKKAGFQKPTPIQSQAWPIVLQGI    211 - 280
DLIGVAQTGTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVY    281 - 350
GGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPD    351 - 420
RQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDLVAVSSVKQNIIVTTEEEKWSHMQTFLQSMSSTDKV    421 - 490
IVFVSRKAVADHLSSDLILGNISVESLHGDREQRDREKALENFKTGKVRILIATDLASRGLDVHDVTHVY    491 - 560
NFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVASELINILERANQSIPEELVSMAERFKAHQQK    561 - 630
REMERKMERPQGRPKKFH                                                        631 - 648
//

Text Mined References (23)

PMID Year Title