Property Summary

NCBI Gene PubMed Count 80
PubMed Score 56.98
PubTator Score 65.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (44)

PMID Text
26265379 However, no significant association was observed between the DDX39B -22 G/C polymorphism in the cases and controls. Furthermore, it is clarified that the protective effect of IL-4 -590 is independent from APOE protective genotypes
25038626 The G allele of DDX39B-22C > G was associated with absent or decreased manifestations of vivax malaria and the C allele was a risk factor for disease complications.
24753416 HIV-1 Rev specifically inhibits the association of ALY/REF and UAP56 with spliced RRE-containing RNA
23125841 HIV-1 Rev specifically inhibits the association of ALY/REF and UAP56 with spliced RRE-containing RNA
22446327 these data identify UAP56 as an important binding partner of Bcr and a novel target for inhibiting vascular smooth muscle cell proliferation.
22071774 We unravel the role of unexplored immunologically important genes, BAT1 and BTNL2, and the haplotypes of the significantly associated SNPs therein, to understand susceptibility to the disease, leprosy and its differential severity.
21859714 Mx proteins exert their antiviral activity against IAV by interfering with the function of the RNA helicases UAP56 and URH49
21799930 UAP56 and URH49 exhibit an intrinsic CRM1-independent nucleocytoplasmic shuttling
21680511 In summary, these data demonstrate that UAP56 is utilized by influenza A viruses to prevent the formation of dsRNA and, hence, the activation of the innate immune response.
21507964 These findings demonstrate that replication of the inlfuenza virus genome is followed by its encapsidation by NP in collaboration with its chaperone UAP56.
21147923 UAP56 binding was shown to represent a unique characteristic of members of the genus Cytomegalovirus that is required for efficient replication of HCMV and required for nuclear mRNA export.
20933106 Observational study of gene-disease association. (HuGE Navigator)
20854863 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20610707 Using a UL69 viral mutant that is unable to bind UAP56 and URH49, the authors demonstrated that UL69's interaction with UAP56 or URH49 does not contribute to the growth phenotype associated with the UL69 deletion mutant.
20573985 Data show that the two closely related RNA helicases UAP56 and URH49 have evolved to form distinct mRNA export machineries, which regulate mitosis at different steps.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20116367 UAP56 is an important regulator of protein synthesis and plays an important role in the regulation of cardiomyocyte growth.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19403039 This report summarizes recent evidence for the role of UAP56 in pre-mRNA splicing and nuclear export.
19264631 The authors demonstrate that ORF57 recruits several members of hTREX, namely Aly, UAP56 and hTHO-complex proteins, onto the viral mRNAs to assemble an export-competent ribonucleoprotein particle.
19115949 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18987644 Observational study of gene-disease association. (HuGE Navigator)
18834321 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18715507 APOE epsilon4 was associated with an independent increase in risk for Alzheimer's disease (AD) in individuals with TNFA -850*2, while carriage of BAT1 -22*2 reduced the risk for AD, independent of APOE epsilon4 genotype
18715507 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18593880 hUAP56 first interacts with U2AF(65) in an ATP-dependent manner, and subsequently with U4/U6 snRNAs to facilitate stepwise assembly of the spliceosome.
18411249 The equilibrium binding of UAP56 in complexes at speckled domains was directly regulated by ATP binding.
18381799 The role of BAT1 in the regulation of tumor necrosis factor-a suggests that BAT1 may regulate the inflammatory response observed in patients with rheumatoid arthritis.
18381799 Observational study of gene-disease association. (HuGE Navigator)
18240960 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17562711 UAP56 has ATPase and helicase activity and roles in spliceosome assembly and mRNA export
17517687 Observational study of gene-disease association. (HuGE Navigator)
17517687 Minor homozygous genotypes of polymorphisms in BAT1 were associated with moderately protective effects against myocardial infarction.
16949217 Reducing the expression of UAP56 and URH49 resulted in a reduction in reporter gene expression as well as cell death within 72 h suggest that both helicases have essential but largely overlapping functions in the processing and export of mammalian mRNAs.
16478985 UAP56 provides a herpesviral regulatory protein with access to a conserved cellular transport system in order to promote nuclear export of unspliced RNA.
16101831 Observational study of gene-disease association. (HuGE Navigator)
15998806 recruitment of the human TREX complex to spliced mRNA is not directly coupled to transcription, but is instead coupled to transcription indirectly through splicing
15969671 Observational study of gene-disease association. (HuGE Navigator)
15843211 Observational study of genotype prevalence. (HuGE Navigator)
15585580 The structures of UAP56/Sub2(BAT1) reveal a unique spatial arrangement of the two conserved helicase domains, and ADP-binding induces significant conformational changes of key residues in the ATP-binding pocket
15028669 BAT1 transcription on the 7.1 AH (diabetes-resistant ancestral haplotype)is modified by interactions involving DNA flanking positions -22 and -348 in the promotor

AA Sequence

MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSE      1 - 70
VQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYM     71 - 140
PNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRD    141 - 210
VQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFD    211 - 280
LLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRG    281 - 350
MDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDI    351 - 420
SSYIEQTR                                                                  421 - 428
//

Text Mined References (93)

PMID Year Title
26265379 2015 Association Study of IL-4 -590 C/T and DDX39B -22 G/C Polymorphisms with the Risk of Late-Onset Alzheimer's Disease in Iranian Population.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
25038626 2014 DDX39B (BAT1), TNF and IL6 gene polymorphisms and association with clinical outcomes of patients with Plasmodium vivax malaria.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23299939 2013 Chtop is a component of the dynamic TREX mRNA export complex.
23222130 2013 Aly and THO are required for assembly of the human TREX complex and association of TREX components with the spliced mRNA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22928037 2012 The proteins PDIP3 and ZC11A associate with the human TREX complex in an ATP-dependent manner and function in mRNA export.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22446327 2012 UAP56 is a novel interacting partner of Bcr in regulating vascular smooth muscle cell DNA synthesis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22197932 2011 Meta-analysis of genome-wide association studies identifies three new risk loci for atopic dermatitis.
22144908 2011 Genome instability and transcription elongation impairment in human cells depleted of THO/TREX.
22071774 2012 Association of variants in BAT1-LTA-TNF-BTNL2 genes within 6p21.3 region show graded risk to leprosy in unrelated cohorts of Indian population.
21912425 2013 A whole-genome association study of major determinants for allopurinol-related Stevens-Johnson syndrome and toxic epidermal necrolysis in Japanese patients.
21859714 2011 Interferon-induced antiviral protein MxA interacts with the cellular RNA helicases UAP56 and URH49.
21799930 2011 The cellular DExD/H-box RNA-helicases UAP56 and URH49 exhibit a CRM1-independent nucleocytoplasmic shuttling activity.
21680511 2011 The cellular RNA helicase UAP56 is required for prevention of double-stranded RNA formation during influenza A virus infection.
21507964 2011 Replication-coupled and host factor-mediated encapsidation of the influenza virus genome by viral nucleoprotein.
21269460 2011 Initial characterization of the human central proteome.
21147923 2011 Characterization of the betaherpesviral pUL69 protein family reveals binding of the cellular mRNA export factor UAP56 as a prerequisite for stimulation of nuclear mRNA export and for efficient viral replication.
20981025 2010 A role for TREX components in the release of spliced mRNA from nuclear speckle domains.
20933106 2011 Autoimmune hepatitis, HLA and extended haplotypes.
20854863 2010 Characterization of tumor necrosis factor-? block haplotypes associated with susceptibility to chronic venous leg ulcers in Caucasian patients.
20844015 2010 ATP is required for interactions between UAP56 and two conserved mRNA export proteins, Aly and CIP29, to assemble the TREX complex.
20828777 2010 Requirement of UAP56, URH49, RBM15, and OTT3 in the expression of Kaposi sarcoma-associated herpesvirus ORF57.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20610707 2010 Binding of the human cytomegalovirus (HCMV) tegument protein UL69 to UAP56/URH49 is not required for efficient replication of HCMV.
20573985 2010 The closely related RNA helicases, UAP56 and URH49, preferentially form distinct mRNA export machineries and coordinately regulate mitotic progression.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20116367 2010 UAP56 is an important regulator of protein synthesis and growth in cardiomyocytes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19836239 2009 UIF, a New mRNA export adaptor that works together with REF/ALY, requires FACT for recruitment to mRNA.
19733147 2009 A dual reporter approach to quantify defects in messenger RNA processing.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19403039 2009 UAP56- a key player with surprisingly diverse roles in pre-mRNA splicing and nuclear export.
19264631 2009 Uncoupling of hTREX demonstrates that UAP56 and hTHO-complex recruitment onto herpesvirus saimiri intronless transcripts is required for replication.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
18987644 2009 Genetic variants of the HLA-A, HLA-B and AIF1 loci show independent associations with type 1 diabetes in Norwegian families.
18974867 2008 Recruitment of the complete hTREX complex is required for Kaposi's sarcoma-associated herpesvirus intronless mRNA nuclear export and virus replication.
18834321 2008 Can we predict neuropathy risk before stavudine prescription in a resource-limited setting?
18715507 2008 Association of alleles carried at TNFA -850 and BAT1 -22 with Alzheimer's disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18593880 2008 Distinct activities of the DExD/H-box splicing factor hUAP56 facilitate stepwise assembly of the spliceosome.
18411249 2008 Binding of ATP to UAP56 is necessary for mRNA export.
18381799 2008 BAT1 promoter polymorphism is associated with rheumatoid arthritis susceptibility.
18240960 2008 Cytokine genotype suggests a role for inflammation in nucleoside analog-associated sensory neuropathy (NRTI-SN) and predicts an individual's NRTI-SN risk.
17984224 2008 ATP-dependent recruitment of export factor Aly/REF onto intronless mRNAs by RNA helicase UAP56.
17562711 2007 Biochemical characterization of the ATPase and helicase activity of UAP56, an essential pre-mRNA splicing and mRNA export factor.
17517687 2007 Association of variants in the BAT1-NFKBIL1-LTA genomic region with protection against myocardial infarction in Europeans.
17190602 2006 Human mRNA export machinery recruited to the 5' end of mRNA.
16949217 2006 Nuclear localization of poly(A)+ mRNA following siRNA reduction of expression of the mammalian RNA helicases UAP56 and URH49.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
16478985 2006 The UL69 transactivator protein of human cytomegalovirus interacts with DEXD/H-Box RNA helicase UAP56 to promote cytoplasmic accumulation of unspliced RNA.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16101831 2005 The haplotype block, NFKBIL1-ATP6V1G2-BAT1-MICB-MICA, within the class III-class I boundary region of the human major histocompatibility complex may control susceptibility to hepatitis C virus-associated dilated cardiomyopathy.
15998806 2005 Recruitment of the human TREX complex to mRNA during splicing.
15969671 2005 Haplotype analysis of a 100 kb region spanning TNF-LTA identifies a polymorphism in the LTA promoter region that is associated with atopic asthma susceptibility in Japan.
15870275 2005 Human hHpr1/p84/Thoc1 regulates transcriptional elongation and physically links RNA polymerase II and RNA processing factors.
15843211 2005 TaqMan assays for genotyping of single nucleotide polymorphisms present at a disease susceptibility locus on chromosome 6.
15833825 2005 Linking transcriptional elongation and messenger RNA export to metastatic breast cancers.
15635413 2005 Nucleolar proteome dynamics.
15585580 2004 Crystal structure of the human ATP-dependent splicing and export factor UAP56.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15338056 2004 Hcc-1 is a novel component of the nuclear matrix with growth inhibitory function.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15296731 2004 Crystal structure of UAP56, a DExD/H-box protein involved in pre-mRNA splicing and mRNA export.
15047853 2004 Growth-regulated expression and G0-specific turnover of the mRNA that encodes URH49, a mammalian DExH/D box protein that is highly related to the mRNA export protein UAP56.
15028669 2004 Polymorphisms at positions -22 and -348 in the promoter of the BAT1 gene affect transcription and the binding of nuclear factors.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12944400 2003 An evolutionarily conserved role for SRm160 in 3'-end processing that functions independently of exon junction complex formation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11979277 2002 TREX is a conserved complex coupling transcription with messenger RNA export.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11675789 2001 Pre-mRNA splicing and mRNA export linked by direct interactions between UAP56 and Aly.
11380625 2001 The central MHC gene, BAT1, may encode a protein that down-regulates cytokine production.
11170743 2001 A second susceptibility gene for developing rheumatoid arthritis in the human MHC is localized within a 70-kb interval telomeric of the TNF genes in the HLA class III region.
10343160 1999 Characterisation of the human central MHC gene, BAT1: genomic structure and expression.
9242493 1997 U2AF65 recruits a novel human DEAD box protein required for the U2 snRNP-branchpoint interaction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8012384 1994 Purification of CpG islands using a methylated DNA binding column.
7601445 1995 The BAT1 gene in the MHC encodes an evolutionarily conserved putative nuclear RNA helicase of the DEAD family.
2911734 1989 A new cluster of genes within the human major histocompatibility complex.
2813433 1989 Human major histocompatibility complex contains a minimum of 19 genes between the complement cluster and HLA-B.