Tbio | ATP-dependent RNA helicase DDX39A |
Isoform 1: Involved in pre-mRNA splicing. Required for the export of mRNA out of the nucleus.
This gene encodes a member of the DEAD box protein family. These proteins are characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene is thought to play a role in the prognosis of patients with gastrointestinal stromal tumors. A pseudogene of this gene is present on chromosome 13. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Sep 2013]
This gene encodes a member of the DEAD box protein family. These proteins are characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene is thought to play a role in the prognosis of patients with gastrointestinal stromal tumors. A pseudogene of this gene is present on chromosome 13. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Sep 2013]
Comments
Disease | Target Count | P-value |
---|---|---|
astrocytoma | 1146 | 5.0e-21 |
oligodendroglioma | 2850 | 1.9e-13 |
non-small cell lung cancer | 2890 | 5.9e-13 |
juvenile dermatomyositis | 1187 | 7.8e-12 |
Breast cancer | 3578 | 4.4e-11 |
glioblastoma | 5792 | 4.2e-10 |
ovarian cancer | 8520 | 5.8e-08 |
acute quadriplegic myopathy | 1158 | 1.4e-07 |
malignant mesothelioma | 3232 | 2.8e-06 |
atypical teratoid / rhabdoid tumor | 5112 | 5.1e-06 |
psoriasis | 6694 | 3.1e-05 |
group 3 medulloblastoma | 4104 | 1.2e-04 |
medulloblastoma, large-cell | 6241 | 1.4e-04 |
interstitial cystitis | 2312 | 3.9e-04 |
adult high grade glioma | 3801 | 5.3e-04 |
adrenocortical carcinoma | 1428 | 1.2e-03 |
primitive neuroectodermal tumor | 3035 | 1.4e-03 |
invasive ductal carcinoma | 2951 | 2.2e-03 |
intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 2.4e-03 |
Multiple myeloma | 1332 | 3.3e-03 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 4.4e-03 |
colon cancer | 1478 | 7.9e-03 |
pancreatic ductal adenocarcinoma liver metastasis | 1962 | 8.9e-03 |
lung cancer | 4740 | 1.9e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Inflammatory bowel disease 6 | 6 | 4.865 | 2.4 |
Lung squamous cell carcinoma | 10 | 3.155 | 1.6 |
Disease | log2 FC | p |
---|---|---|
acute quadriplegic myopathy | 1.240 | 1.4e-07 |
adrenocortical carcinoma | 1.204 | 1.2e-03 |
adult high grade glioma | 1.200 | 5.3e-04 |
astrocytoma | 1.300 | 5.0e-21 |
atypical teratoid / rhabdoid tumor | 1.300 | 5.1e-06 |
Breast cancer | 1.100 | 4.4e-11 |
colon cancer | 1.600 | 7.9e-03 |
glioblastoma | 1.600 | 4.2e-10 |
group 3 medulloblastoma | 1.700 | 1.2e-04 |
interstitial cystitis | 1.100 | 3.9e-04 |
intraductal papillary-mucinous carcinoma... | 1.100 | 4.4e-03 |
intraductal papillary-mucinous neoplasm ... | 1.700 | 2.4e-03 |
invasive ductal carcinoma | 1.200 | 2.2e-03 |
juvenile dermatomyositis | 1.031 | 7.8e-12 |
lung cancer | 1.200 | 1.9e-02 |
malignant mesothelioma | 1.300 | 2.8e-06 |
medulloblastoma, large-cell | 1.800 | 1.4e-04 |
Multiple myeloma | 1.110 | 3.3e-03 |
non-small cell lung cancer | 1.079 | 5.9e-13 |
oligodendroglioma | 1.400 | 1.9e-13 |
ovarian cancer | 3.200 | 5.8e-08 |
pancreatic ductal adenocarcinoma liver m... | 1.167 | 8.9e-03 |
primitive neuroectodermal tumor | 1.500 | 1.4e-03 |
psoriasis | 2.300 | 3.1e-05 |
Species | Source | Disease |
---|---|---|
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA |
MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEV 1 - 70 QHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMP 71 - 140 SVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDV 141 - 210 QEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDL 211 - 280 LDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGM 281 - 350 DIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELPEEIDIS 351 - 420 TYIEQSR 421 - 427 //