Property Summary

NCBI Gene PubMed Count 34
PubMed Score 16.46
PubTator Score 22.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Gene RIF (13)

PMID Text
26469522 DDX39A is a potential biomarker for unfavorable neuroblastoma
23749908 The protein levels of DDX39 were found to be higher in malignant pleural mesothelioma cell lines compared to normal pleural mesothelial cells.
22494014 Results suggest that DDX39 is a suppressor of invasion and loss of its function predicts disease progression in bladder cancers.
22119546 -dependent RNA helicase DDX39 has a role in poor prognosis of patients with gastrointestinal stromal tumor
21859714 Mx proteins exert their antiviral activity against IAV by interfering with the function of the RNA helicases UAP56 and URH49
21799930 UAP56 and URH49 exhibit an intrinsic CRM1-independent nucleocytoplasmic shuttling
21388492 Requirement of DDX39 DEAD box RNA helicase for genome integrity and telomere protection
20610707 Using a UL69 viral mutant that is unable to bind UAP56 and URH49, the authors demonstrated that UL69's interaction with UAP56 or URH49 does not contribute to the growth phenotype associated with the UL69 deletion mutant.
20573985 Data show that the two closely related RNA helicases UAP56 and URH49 have evolved to form distinct mRNA export machineries, which regulate mitosis at different steps.
17548965 DDX39 is a novel RNA helicase capable of promoting cancer cell growth
17196963 CIP29 physically and functionally associates with DDX39, suggesting their cooperation in the RNA metabolism.
16949217 Reducing the expression of UAP56 and URH49 resulted in a reduction in reporter gene expression as well as cell death within 72 h suggest that both helicases have essential but largely overlapping functions in the processing and export of mammalian mRNAs.
15047853 Regulation of URH49 mRNA expression and comparison with the related UAP56 RNA helicase.

AA Sequence

MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEV      1 - 70
QHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMP     71 - 140
SVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDV    141 - 210
QEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDL    211 - 280
LDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGM    281 - 350
DIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELPEEIDIS    351 - 420
TYIEQSR                                                                   421 - 427
//

Text Mined References (44)

PMID Year Title
26469522 2016 Identification of DDX39A as a Potential Biomarker for Unfavorable Neuroblastoma Using a Proteomic Approach.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23749908 2013 Up-regulation of DDX39 in human malignant pleural mesothelioma cell lines compared to normal pleural mesothelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22494014 2012 DDX39 acts as a suppressor of invasion for bladder cancer.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22197932 2011 Meta-analysis of genome-wide association studies identifies three new risk loci for atopic dermatitis.
22119546 2012 Clinical proteomics identified ATP-dependent RNA helicase DDX39 as a novel biomarker to predict poor prognosis of patients with gastrointestinal stromal tumor.
21912425 2013 A whole-genome association study of major determinants for allopurinol-related Stevens-Johnson syndrome and toxic epidermal necrolysis in Japanese patients.
21859714 2011 Interferon-induced antiviral protein MxA interacts with the cellular RNA helicases UAP56 and URH49.
21799930 2011 The cellular DExD/H-box RNA-helicases UAP56 and URH49 exhibit a CRM1-independent nucleocytoplasmic shuttling activity.
21388492 2011 Requirement of DDX39 DEAD box RNA helicase for genome integrity and telomere protection.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20844015 2010 ATP is required for interactions between UAP56 and two conserved mRNA export proteins, Aly and CIP29, to assemble the TREX complex.
20610707 2010 Binding of the human cytomegalovirus (HCMV) tegument protein UL69 to UAP56/URH49 is not required for efficient replication of HCMV.
20573985 2010 The closely related RNA helicases, UAP56 and URH49, preferentially form distinct mRNA export machineries and coordinately regulate mitotic progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17548965 2007 DDX39, upregulated in lung squamous cell cancer, displays RNA helicase activities and promotes cancer cell growth.
17196963 2007 Intracellular characterization of DDX39, a novel growth-associated RNA helicase.
16949217 2006 Nuclear localization of poly(A)+ mRNA following siRNA reduction of expression of the mammalian RNA helicases UAP56 and URH49.
16478985 2006 The UL69 transactivator protein of human cytomegalovirus interacts with DEXD/H-Box RNA helicase UAP56 to promote cytoplasmic accumulation of unspliced RNA.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15338056 2004 Hcc-1 is a novel component of the nuclear matrix with growth inhibitory function.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15047853 2004 Growth-regulated expression and G0-specific turnover of the mRNA that encodes URH49, a mammalian DExH/D box protein that is highly related to the mRNA export protein UAP56.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11979277 2002 TREX is a conserved complex coupling transcription with messenger RNA export.
11790298 2002 Directed proteomic analysis of the human nucleolus.
7601445 1995 The BAT1 gene in the MHC encodes an evolutionarily conserved putative nuclear RNA helicase of the DEAD family.