Property Summary

NCBI Gene PubMed Count 36
PubMed Score 545.13
PubTator Score 31.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.476 1.7e-03
psoriasis 1.200 5.1e-04
non diabetic and post-ischemic heart fai... -1.200 1.1e-02
medulloblastoma, large-cell 1.700 7.8e-05
juvenile dermatomyositis 1.062 1.1e-10
acute quadriplegic myopathy 1.477 3.2e-07
lung cancer 1.400 2.3e-02
colon cancer 1.500 2.5e-05
diabetes mellitus -1.300 2.4e-02
group 3 medulloblastoma 1.300 8.0e-05
primary Sjogren syndrome 1.100 3.5e-02
ulcerative colitis 1.200 8.6e-06
ovarian cancer 1.500 4.4e-04
dermatomyositis 1.300 1.1e-03

 MGI Phenotype (1)

Gene RIF (14)

PMID Text
27033607 In dengue virus infected cells, DDX21 translocates from nucleus to cytoplasm to active the innate immune response and thus inhibits DENV replication in the early stages of infection.
25477391 Identification of several late-acting snoRNAs that bind pre-40S particles in human cells and show that their association and function in pre-40S complexes is regulated by the RNA helicase DDX21.
25470060 results uncover the multifaceted role of DDX21 in multiple steps of ribosome biogenesis, and provide evidence implicating a mammalian RNA helicase in RNA modification and Pol II elongation control
25260534 DDX21 expression in breast cancer cells can promote AP-1 activity and rRNA processing, and thus, promote tumorigenesis by two independent mechanisms.
24721576 As sequential interaction of PB1 and NS1 with DDX21 leads to temporal regulation of viral gene expression, influenza A virus likely uses the DDX21-NS1 interaction not only to overcome restriction, but also to regulate the viral life cycle.
23608157 DDX5 interacts with DDX21 and synergistically enhances the Rev function
23419719 Data indicate that DDX21, a nucleolar protein, was confirmed to associate with SET8.
23125841 DDX5 interacts with DDX21 and synergistically enhances the Rev function
20873769 Studies indicated that DDX21, HNRNPC, and RCC2 were isolated from Ku86 multicomponent complex in response to DNA damage.
19454010 DDX5 interacts with DDX21 and synergistically enhances the Rev function
18180292 in addition to its transcriptional effects, c-Jun regulates rRNA processing and nucleolar compartmentalization of the rRNA processing protein DDX21
16385451 Observational study of gene-disease association. (HuGE Navigator)
16045751 the function of Gu(alpha)in rRNA processing is at least partially dependent on its ability to interact with ribosomal protein L4.
14559904 RNA helicase II/Gualpha silencing inhibits mammalian ribosomal RNA production

AA Sequence

MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMN      1 - 70
SPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMN     71 - 140
GETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIPVEQKEGAFSNFPISEETIKLLKGRGVTFLF    141 - 210
PIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDF    211 - 280
SDITKKLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFA    281 - 350
DQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHW    351 - 420
TQRAAVIGDVIRVYSGHQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGV    421 - 490
LVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKF    491 - 560
KRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATSVDQRSLI    561 - 630
NSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDS    631 - 700
RRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQN    701 - 770
KGQKRSFSKAFGQ                                                             771 - 783
//

Text Mined References (54)

PMID Year Title
27033607 2016 DDX21 translocates from nucleus to cytoplasm and stimulates the innate immune response due to dengue virus infection.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25477391 2015 The association of late-acting snoRNPs with human pre-ribosomal complexes requires the RNA helicase DDX21.
25470060 2015 RNA helicase DDX21 coordinates transcription and ribosomal RNA processing.
25416956 2014 A proteome-scale map of the human interactome network.
25260534 2014 Elevated DDX21 regulates c-Jun activity and rRNA processing in human breast cancers.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24721576 2014 Cellular DDX21 RNA helicase inhibits influenza A virus replication but is counteracted by the viral NS1 protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23848194 2013 Nucleolar scaffold protein, WDR46, determines the granular compartmental localization of nucleolin and DDX21.
23419719 2013 Proteome identification of proteins interacting with histone methyltransferase SET8.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21536856 2011 Splicing factor 2-associated protein p32 participates in ribosome biogenesis by regulating the binding of Nop52 and fibrillarin to preribosome particles.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20873769 2010 Online nanoflow RP-RP-MS reveals dynamics of multicomponent Ku complex in response to DNA damage.
20800221 2010 Genome-wide association scan of trait depression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18180292 2008 c-Jun supports ribosomal RNA processing and nucleolar localization of RNA helicase DDX21.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16603771 2006 The WSTF-SNF2h chromatin remodeling complex interacts with several nuclear proteins in transcription.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
16045751 2005 Functional interaction between RNA helicase II/Gu(alpha) and ribosomal protein L4.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559904 2003 Silencing of RNA helicase II/Gualpha inhibits mammalian ribosomal RNA production.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11891046 2002 Genomic structure of newly identified paralogue of RNA helicase II/Gu: detection of pseudogenes and multiple alternatively spliced mRNAs.
11823437 2002 The DEXD/H-box RNA helicase RHII/Gu is a co-factor for c-Jun-activated transcription.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11237763 2001 Human RNA helicase II/Gu gene: genomic organization and promoter analysis.
10860663 2000 Mouse RNA helicase II/Gu: cDNA and genomic sequences, chromosomal localization, and regulation of expression.
9461305 1997 RNA-unwinding and RNA-folding activities of RNA helicase II/Gu--two activities in separate domains of the same protein.
9177271 1997 Cloning and characterization of Gu/RH-II binding protein.
8614622 1996 A nucleolar RNA helicase recognized by autoimmune antibodies from a patient with watermelon stomach disease.