Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.48
PubTator Score 4.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.800 7.5e-05
osteosarcoma 1.362 4.6e-04
sonic hedgehog group medulloblastoma 1.200 4.1e-03
glioblastoma 1.100 2.1e-02
medulloblastoma, large-cell 1.500 4.1e-04
primitive neuroectodermal tumor 1.100 5.1e-05
acute quadriplegic myopathy 1.440 7.7e-07
ovarian cancer 1.700 7.0e-04
dermatomyositis 1.200 3.6e-04

Gene RIF (5)

PMID Text
25284587 Data show that odulation of RNA helicase DDX18 directly affects growth of tamoxifen-resistant cells, suggesting that it may be a critical downstream effector of the estrogen receptors (ERs) and high mobility group box 2 (HMGB2) complex.
22944692 Positional proteomics analysis identifies the cleavage of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 (DDX18) at amino acid residues 35-36 by the HIV-1 protease
21653321 We identified 4 nonsynonymous sequence variants of DDX18 in acute myeloid leukemia patient samples
20689807 Observational study of gene-disease association. (HuGE Navigator)
18351129 findings suggest that MrDb is important for cell proliferation and that its inhibition could prevent tumor cell proliferation.

AA Sequence

MSHLPMKLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQN      1 - 70
GGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEES     71 - 140
AETTKETENNVEKPDNDEDESEVPSLPLGLTGAFEDTSFASLCNLVNENTLKAIKEMGFTNMTEIQHKSI    141 - 210
RPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVH    211 - 280
TYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQI    281 - 350
IKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYVGVDDDKANATVDGLEQGYVVCPSEKRFLLLFTFL    351 - 420
KKNRKKKLMVFFSSCMSVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGTLLCTDVAARGLD    421 - 490
IPEVDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALLILRPEELGFLRYLKQSKVPLSEFDFSWSKISD    491 - 560
IQSQLEKLIEKNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPFVDLNVNSNEG    561 - 630
KQKKRGGGGGFGYQKTKKVEKSKIFKHISKKSSDSRQFSH                                  631 - 670
//

Text Mined References (19)

PMID Year Title
25284587 2015 Genomic interaction between ER and HMGB2 identifies DDX18 as a novel driver of endocrine resistance in breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21653321 2011 Ddx18 is essential for cell-cycle progression in zebrafish hematopoietic cells and is mutated in human AML.
21269460 2011 Initial characterization of the human central proteome.
20941364 2010 Comparative structural analysis of human DEAD-box RNA helicases.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18351129 2007 Cellular studies of MrDb (DDX18).
16963496 2006 NOP132 is required for proper nucleolus localization of DEAD-box RNA helicase DDX47.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8861962 1996 Myc-Max heterodimers activate a DEAD box gene and interact with multiple E box-related sites in vivo.