Property Summary

NCBI Gene PubMed Count 46
PubMed Score 135.65
PubTator Score 103.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.200 3.9e-02
interstitial lung disease 1.600 7.1e-03
astrocytic glioma 3.100 9.7e-03
ependymoma 3.100 1.6e-02
oligodendroglioma 3.900 1.0e-03
psoriasis -1.500 1.3e-04
osteosarcoma 4.919 6.3e-11
medulloblastoma 1.300 3.8e-04
primitive neuroectodermal tumor 1.600 1.6e-05
Crohn's disease -1.191 1.7e-03
juvenile dermatomyositis 1.194 4.4e-05
acute quadriplegic myopathy 1.103 7.2e-03
intraductal papillary-mucinous adenoma (... 1.500 2.2e-03
breast carcinoma 1.500 1.6e-02
cystic fibrosis -2.800 6.0e-06
invasive ductal carcinoma 1.059 3.3e-02
Pick disease 1.300 3.0e-03
progressive supranuclear palsy -1.100 7.0e-03
Breast cancer -2.300 3.1e-02
ovarian cancer -4.100 7.9e-09
head and neck cancer and chronic obstruc... -1.700 9.1e-03

Gene RIF (31)

PMID Text
26362536 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
26312911 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
26312911 siRNA knockdown of DDX17 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.
26209609 Systematic Determination of Human Cyclin Dependent Kinase (CDK)-9 Interactome Identifies Novel Functions in RNA Splicing Mediated by the DDX5 and DDX17 RNA Helicases
25701821 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
25701821 siRNA knockdown of DDX17 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.
25496916 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
25126784 Depletion of DDX17 but not the related helicase DDX5 increased Rift Valley fever virus replication in human cells.
24910439 Downregulation of DDX5 and DDX17 protein expression during myogenesis and epithelial-to-mesenchymal transdifferentiation contributes to the switching of splicing programs during these processes.
23769241 DDX17 promotes the production of HIV-1 infectious particles by modulating HIV-1 RNA metabolism.
23769241 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
23769241 siRNA knockdown of DDX17 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.
23608157 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
23125841 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
23022728 RNA helicases Ddx17 and Ddx5 contribute to tumor-cell invasiveness by regulating alternative splicing of several DNA- and chromatin-binding factors, including the macroH2A1 histone.
22944692 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
22266867 Data indicate that transcriptional coregulator ddx5/ddx17 RNA helicases can simultaneously regulate the transcriptional activity and alternative splicing of NFAT5 transcription factor.
22174317 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
22174317 siRNA knockdown of DDX17 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.
20663877 Pleiotropic effects of p300-mediated acetylation on p68 and p72 RNA helicase.
19902070 Short-term exercise resulted in a significant increase of mRNA expression of genes encoding proteins involved in the formation of precatalytic splisosome: DDX17.
19718048 A crucial role for p72 in ERalpha co-activation and oestrogen-dependent cell growth.
19059367 putative AR co-factor, DDX17, is known to be a co-factor for estrogen receptor alpha (ERalpha), but has never been associated
18334637 p72 is required for the optimal activity of zinc-finger antiviral protein
18005418 The DEAD-box proteins p68(Ddx5) and p72(Ddx17) were used as models for this coexpression frequency analysis as there are defined functions for these proteins in splicing and transcription.
17699760 p68/p72 may contribute to colon cancer formation by directly up-regulating proto-oncogenes and indirectly by down-regulating the growth suppressor p21(WAF1/CIP1).
17226766 p72 RNA helicase may not only be involved in the p53-Mdm2 regulatory loop, but also profoundly impact on the transcriptome through various CBP/p300 and P/CAF interacting proteins.
15298701 p72 is an important transcriptional regulator, functioning as a co-activator and/or co-repressor depending on the context of the promoter & the transcriptional complex. AA 1-474 of p72 can repress transcription as well as the full-length protein.
12193588 has a role in pre-mRNA splicing, in particular, at the early stages of the splicing reaction involving U1snRNP
12138182 Results show that the abundant DEAD-box RNA helicase p72, but not its close relative p68, affects the splicing of alternative exons containing AC-rich exon enhancer elements.
11675387 Alternate protein isoforms arise through the use of a non-AUG (CUG) and a downstream in-frame AUG translation initiation codons.

AA Sequence

MPTGFVAPILCVLLPSPTREAATVASATGDSASERESAAPAAAPTAEAPPPSVVTRPEPQALPSPAIRAP      1 - 70
LPDLYPFGTMRGGGFGDRDRDRDRGGFGARGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPE     71 - 140
VARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRD    141 - 210
MVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYG    211 - 280
GAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDR    281 - 350
QTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENK    351 - 420
TIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFV    421 - 490
INYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGG    491 - 560
GGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQA    561 - 630
GQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQP    631 - 700
PGATNMIGYMGQTAYQYPPPPPPPPPSRK                                             701 - 729
//

Text Mined References (64)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26209609 2015 Systematic Determination of Human Cyclin Dependent Kinase (CDK)-9 Interactome Identifies Novel Functions in RNA Splicing Mediated by the DEAD Box (DDX)-5/17 RNA Helicases.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25604459 2015 Identification of cytoplasmic proteins interacting with unliganded estrogen receptor ? and ? in human breast cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25126784 2014 Stem-loop recognition by DDX17 facilitates miRNA processing and antiviral defense.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24910439 2014 RNA helicases DDX5 and DDX17 dynamically orchestrate transcription, miRNA, and splicing programs in cell differentiation.
24581491 2014 Hippo signaling regulates microprocessor and links cell-density-dependent miRNA biogenesis to cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23769241 2013 DDX17 promotes the production of infectious HIV-1 particles through modulating viral RNA packaging and translation frameshift.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23022728 2012 Splicing switch of an epigenetic regulator by RNA helicases promotes tumor-cell invasiveness.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22266867 2012 Dual role of the ddx5/ddx17 RNA helicases in the control of the pro-migratory NFAT5 transcription factor.
22002106 2012 Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.
21876179 2011 Zinc-finger antiviral protein inhibits HIV-1 infection by selectively targeting multiply spliced viral mRNAs for degradation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21182205 2011 Identification of proteins associated with ligand-activated estrogen receptor ? in human breast cancer cell nuclei by tandem affinity purification and nano LC-MS/MS.
20663877 2010 Pleiotropic effects of p300-mediated acetylation on p68 and p72 RNA helicase.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19995069 2010 Sumoylation of p68 and p72 RNA helicases affects protein stability and transactivation potential.
19946888 2010 Defining the membrane proteome of NK cells.
19902070 2009 Changed profile of splicing regulator genes expression in response to exercise.
19718048 2009 The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer.
19059367 2009 DNA dependent recruitment of DDX17 and other interacting proteins by the human androgen receptor.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18334637 2008 p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein.
18005418 2007 Identification of novel pathway partners of p68 and p72 RNA helicases through Oncomine meta-analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17699760 2007 Involvement of RNA helicases p68 and p72 in colon cancer.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17226766 2007 Concerted activation of the Mdm2 promoter by p72 RNA helicase and the coactivators p300 and P/CAF.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17011493 2006 The RNA helicases p68/p72 and the noncoding RNA SRA are coregulators of MyoD and skeletal muscle differentiation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15660129 2005 The DEAD box protein p68: a novel transcriptional coactivator of the p53 tumour suppressor.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15298701 2004 The p68 and p72 DEAD box RNA helicases interact with HDAC1 and repress transcription in a promoter-specific manner.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12595555 2003 The highly related DEAD box RNA helicases p68 and p72 exist as heterodimers in cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12193588 2002 RH70, a bidirectional RNA helicase, co-purifies with U1snRNP.
12138182 2002 Regulation of alternative splicing by the ATP-dependent DEAD-box RNA helicase p72.
11675387 2002 The mRNA of DEAD box protein p72 is alternatively translated into an 82-kDa RNA helicase.
11250900 2001 A subfamily of RNA-binding DEAD-box proteins acts as an estrogen receptor alpha coactivator through the N-terminal activation domain (AF-1) with an RNA coactivator, SRA.
10591208 1999 The DNA sequence of human chromosome 22.
9747670 1998 The protein family of RNA helicases.
9110174 1997 Large-scale concatenation cDNA sequencing.
8871553 1996 p72: a human nuclear DEAD box protein highly related to p68.
8619474 1996 A "double adaptor" method for improved shotgun library construction.