Property Summary

NCBI Gene PubMed Count 54
PubMed Score 141.14
PubTator Score 103.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.103 7.2e-03
astrocytic glioma 2.800 2.7e-03
Breast cancer -1.100 4.0e-05
breast carcinoma 1.500 1.6e-02
Crohn's disease -1.191 1.7e-03
cystic fibrosis -2.500 2.4e-06
ependymoma 1.200 2.6e-03
group 4 medulloblastoma 1.200 1.5e-02
head and neck cancer and chronic obstruc... -1.700 9.1e-03
interstitial lung disease 1.100 3.4e-02
intraductal papillary-mucinous adenoma (... 1.500 2.2e-03
invasive ductal carcinoma 1.059 3.3e-02
juvenile dermatomyositis 1.040 2.7e-05
oligodendroglioma 1.100 2.4e-03
osteosarcoma 1.114 1.7e-04
ovarian cancer -1.600 1.5e-07
Pick disease -1.200 3.0e-05
primitive neuroectodermal tumor 1.500 6.9e-03
progressive supranuclear palsy -1.100 7.0e-03
psoriasis -1.500 1.3e-04
Rheumatoid arthritis 1.200 3.9e-02

Gene RIF (36)

AA Sequence

MPTGFVAPILCVLLPSPTREAATVASATGDSASERESAAPAAAPTAEAPPPSVVTRPEPQALPSPAIRAP      1 - 70
LPDLYPFGTMRGGGFGDRDRDRDRGGFGARGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPE     71 - 140
VARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRD    141 - 210
MVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYG    211 - 280
GAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDR    281 - 350
QTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENK    351 - 420
TIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFV    421 - 490
INYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGG    491 - 560
GGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQA    561 - 630
GQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQP    631 - 700
PGATNMIGYMGQTAYQYPPPPPPPPPSRK                                             701 - 729
//

Text Mined References (79)

PMID Year Title