Property Summary

NCBI Gene PubMed Count 30
PubMed Score 30.01
PubTator Score 28.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Warsaw breakage syndrome 11 7.778 3.9
Chromosome Breakage 36 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.300 2.6e-05
atypical teratoid / rhabdoid tumor 1.500 2.2e-07
colon cancer 1.500 8.4e-04
glioblastoma 1.200 8.0e-08
group 3 medulloblastoma 1.400 1.7e-04
lung cancer 1.500 4.0e-03
malignant mesothelioma 1.500 2.4e-06
medulloblastoma, large-cell 1.800 3.8e-06
osteosarcoma -1.337 1.4e-04
primitive neuroectodermal tumor 1.500 3.1e-04

Gene RIF (19)

AA Sequence

MANETQKVGAIHFPFPFTPYSIQEDFMAELYRVLEAGKIGIFESPTGTGKSLSLICGALSWLRDFEQKKR      1 - 70
EEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLVDRLKAEQARRKQR     71 - 140
EERLQQLQHRVQLKYAAKRLRQEEEERENLLRLSREMLETGPEAERLEQLESGEEELVLAEYESDEEKKV    141 - 210
ASRVDEDEDDLEEEHITKIYYCSRTHSQLAQFVHEVKKSPFGKDVRLVSLGSRQNLCVNEDVKSLGSVQL    211 - 280
INDRCVDMQRSRHEKKKGAEEEKPKRRRQEKQAACPFYNHEQMGLLRDEALAEVKDMEQLLALGKEARAC    281 - 350
PYYGSRLAIPAAQLVVLPYQMLLHAATRQAAGIRLQDQVVIIDEAHNLIDTITGMHSVEVSGSQLCQAHS    351 - 420
QLLQYVERYGKRLKAKNLMYLKQILYLLEKFVAVLGGNIKQNPNTQSLSQTGTELKTINDFLFQSQIDNI    421 - 490
NLFKVQRYCEKSMISRKLFGFTERYGAVFSSREQPKLAGFQQFLQSLQPRTTEALAAPADESQASTLRPA    491 - 560
SPLMHIQGFLAALTTANQDGRVILSRQGSLSQSTLKFLLLNPAVHFAQVVKECRAVVIAGGTMQPVSDFR    561 - 630
QQLLACAGVEAERVVEFSCGHVIPPDNILPLVICSGISNQPLEFTFQKRELPQMMDEVGRILCNLCGVVP    631 - 700
GGVVCFFPSYEYLRQVHAHWEKGGLLGRLAARKKIFQEPKSAHQVEQVLLAYSRCIQACGQERGQVTGAL    701 - 770
LLSVVGGKMSEGINFSDNLGRCVVMVGMPFPNIRSAELQEKMAYLDQTLSPRPGTPREGSGGEPVHEGRQ    771 - 840
PVHRQGHQAPEGFCQRSAPGPAICPAPCPGQAAGLDPSPCGGQSYLWPRHCCCAEVSPGEVGLFLMGNHT    841 - 910
TAWRRALPLSCPLETVFVVGVVCGDPVTKVKPRRRVWSPECCQDPGTGVSSRRRKWGNPE              911 - 970
//

Text Mined References (34)

PMID Year Title