Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.48
PubTator Score 9.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.3e-04
psoriasis 6694 3.9e-04
oligodendroglioma 2850 2.8e-03
diabetes mellitus 1728 9.0e-03
lung cancer 4740 4.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
acute myeloid leukemia 783 3.548 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.100 9.0e-03
lung cancer 1.300 4.9e-02
oligodendroglioma -1.100 2.8e-03
ovarian cancer 1.100 1.3e-04
psoriasis 1.100 3.9e-04

Gene RIF (7)

AA Sequence

MGKTANSPGSGARPDPVRSFNRWKKKHSHRQNKKKQLRKQLKKPEWQVERESISRLMQNYEKINVNEITR      1 - 70
FSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEALYRLQWTSTD     71 - 140
GLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGGKDLKHEAERINNINILVCTPGRLLQHMDETVS    141 - 210
FHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLARLSLKNPEYVWVHEKA    211 - 280
KYSTPATLEQNYIVCELQQKISVLYSFLRSHLKKKSIVFFSSCKEVQYLYRVFCRLRPGVSILALHGRQQ    281 - 350
QMRRMEVYNEFVRKRAAVLFATDIAARGLDFPAVNWVLQFDCPEDANTYIHRAGRTARYKEDGEALLILL    351 - 420
PSEKAMVQQLLQKKVPVKEIKINPEKLIDVQKKLESILAQDQDLKERAQRCFVSYVRSVYLMKDKEVFDV    421 - 490
SKLPIPEYALSLGLAVAPRVRFLQKMQKQPTKELVRSQADKVIEPRAPSLTNDEVEEFRAYFNEKMSILQ    491 - 560
KGGKRLEGTEHRQDNDTGNEEQEEEEDDEEEMEEKLAKAKGSQAPSLPNTSEAQKIKEVPTQFLDRDEEE    561 - 630
EDADFLKVKRHNVFGLDLKDEKTLQKKEPSKSSIKKKMTKVAEAKKVMKRNFKVNKKITFTDEGELVQQW    631 - 700
PQMQKSAIKDAEEDDDTGGINLHKAKERLQEEDKFDKEEYRKKIKAKHREKRLKEREARREANKRQAKAK    701 - 770
DEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKKQGMKKRSNSEVEDVGPTS    771 - 840
HNRKKARWDTLEPLDTGLSLAEDEELVLHLLRSQS                                       841 - 875
//

Text Mined References (27)

PMID Year Title