Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Velocardiofacial syndrome 46 3.598 1.8

Expression

Gene RIF (3)

AA Sequence

MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT      1 - 70
AEDNRSHSAHFFEFLTKELALGQDRFPTVLSTSPAAHGGPRCPGEIIEGKKSCLNEEALFIYFI           71 - 134
//

Text Mined References (9)

PMID Year Title