Property Summary

NCBI Gene PubMed Count 27
PubMed Score 60.83
PubTator Score 125.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.400 5.4e-04
osteosarcoma -1.179 5.5e-04
pancreatic ductal adenocarcinoma liver m... -1.515 1.9e-02
intraductal papillary-mucinous carcinoma... -1.200 3.8e-02
intraductal papillary-mucinous neoplasm ... -1.400 4.5e-02
diabetes mellitus -1.400 7.3e-03
group 4 medulloblastoma -1.100 3.5e-03
ovarian cancer 1.300 9.6e-04

Gene RIF (12)

PMID Text
26234719 High MIF-2 levels are predictive of the development of organ dysfunction in myocardial ischemia reperfusion injury.
24932684 Both p53 wildtype and mutant human lung adenocarcinoma tumors rely on MIF family members for maximal cell growth and survival.
24356968 findings identify DDT as a functionally redundant but more potent cytokine to MIF in cancer and suggest that current attempts to inhibit MIF signaling may fail because of DDT compensation.
22951300 D-dopachrome tautomerase secreted from adipocytes acts on preadipocytes to promote IL-6 expression and to inhibit adipogenesis by suppressing the induction of genes encoding adipogenic regulators
22428043 DDT acts on adipocytes to regulate lipid metabolism through AMPK and/or PKA pathway(s) and improves glucose intolerance caused by obesity.
21817065 These data indicate that D-DT is a MIF-like cytokine.
21071513 D-DT-dependent beta-catenin stabilization is regulated by COX-2 expression, suggesting the existence of an amplification loop between COX-2- and beta-catenin-mediated transcription in these cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18684922 D-dopachrome tautomerase (D-DT) and macrophage migration inhibitory factor, individually and additively, promote vascular endothelial growth factor and CXCL8 expression in human lung adenocarcinoma cell lines.
12823441 DDT is for the first time demonstrated in the skin and can be related to inflammation, and its covariation with MIF strengthens this observation.
11997397 role of tautomerase active site of macrophage migration inhibitory factor as a potential target for discovery of novel anti-inflammatory agents

AA Sequence

MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT      1 - 70
AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL                           71 - 118
//

Text Mined References (29)

PMID Year Title
26234719 2015 Interaction of MIF Family Proteins in Myocardial Ischemia/Reperfusion Damage and Their Influence on Clinical Outcome of Cardiac Surgery Patients.
24932684 2014 MIF family members cooperatively inhibit p53 expression and activity.
24356968 2014 Dysregulated D-dopachrome tautomerase, a hypoxia-inducible factor-dependent gene, cooperates with macrophage migration inhibitory factor in renal tumorigenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22951300 2012 D-dopachrome tautomerase promotes IL-6 expression and inhibits adipogenesis in preadipocytes.
22428043 2012 The action of D-dopachrome tautomerase as an adipokine in adipocyte lipid metabolism.
21817065 2011 The D-dopachrome tautomerase (DDT) gene product is a cytokine and functional homolog of macrophage migration inhibitory factor (MIF).
21269460 2011 Initial characterization of the human central proteome.
21071513 2010 The MIF homologue D-dopachrome tautomerase promotes COX-2 expression through ?-catenin-dependent and -independent mechanisms.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18684922 2008 Cooperative regulation of non-small cell lung carcinoma angiogenic potential by macrophage migration inhibitory factor and its homolog, D-dopachrome tautomerase.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12823441 2003 UVB-induced inflammation gives increased d-dopachrome tautomerase activity in blister fluid which correlates with macrophage migration inhibitory factor.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997397 2002 The tautomerase active site of macrophage migration inhibitory factor is a potential target for discovery of novel anti-inflammatory agents.
10591208 1999 The DNA sequence of human chromosome 22.
10079069 1999 Crystal structure of human D-dopachrome tautomerase, a homologue of macrophage migration inhibitory factor, at 1.54 A resolution.
9729470 1998 Structure and organization of the human theta-class glutathione S-transferase and D-dopachrome tautomerase gene complex.
9716662 1998 Conserved gene structure and genomic linkage for D-dopachrome tautomerase (DDT) and MIF.
9480844 1998 Molecular cloning of human D-dopachrome tautomerase cDNA: N-terminal proline is essential for enzyme activation.
8267597 1993 Isolation of a new tautomerase monitored by the conversion of D-dopachrome to 5,6-dihydroxyindole.
1286669 1992 Human liver protein map: a reference database established by microsequencing and gel comparison.