Property Summary

NCBI Gene PubMed Count 19
PubMed Score 40.69
PubTator Score 200.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.239 3.6e-03
Multiple myeloma 1.810 1.8e-04
osteosarcoma 1.231 3.9e-03
ependymoma 1.200 2.6e-12
glioblastoma 2.100 2.0e-03
group 3 medulloblastoma 1.400 1.4e-03
astrocytoma 1.100 7.3e-03
atypical teratoid/rhabdoid tumor 1.500 7.8e-09
medulloblastoma, large-cell 1.300 2.9e-05
intraductal papillary-mucinous neoplasm ... -1.900 1.2e-03
lung cancer 1.100 2.0e-04
diabetes mellitus -1.100 1.0e-02
pediatric high grade glioma 1.400 2.5e-07
pilocytic astrocytoma 1.300 9.8e-07
non primary Sjogren syndrome sicca 1.200 4.1e-02
lung adenocarcinoma 1.459 2.8e-10
ovarian cancer 2.100 4.8e-05

Gene RIF (7)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify dolichyl-diphosphooligosaccharide--protein glycosyltransferase, HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22305527 Found a 22 bp deletion and a missense mutation in DDOST.
20490454 The common SNPs tested in DDOST, PRKCSH and LGALS3 do not seem to be associated with diabetic micro- or macrovascular complications or with type 1 diabetes in Finnish patients.
20490454 Observational study of gene-disease association. (HuGE Navigator)
19955485 AGER1 provides protection against AGE-induced reactive oxygen species generation via NADPH oxidase and protein kinase C delta.
19343046 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of dolichyl-diphosphooligosaccharide--protein glycosyltransferase (DDOST; OST48) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MGYFRCARAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVLLDNLNVRETHSLFFRSLKDR      1 - 70
GFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRE     71 - 140
LGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPL    141 - 210
VLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGS    211 - 280
QRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDG    281 - 350
DDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYER    351 - 420
FIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD                                      421 - 456
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22305527 2012 DDOST mutations identified by whole-exome sequencing are implicated in congenital disorders of glycosylation.
22016385 2011 Selenoprotein K binds multiprotein complexes and is involved in the regulation of endoplasmic reticulum homeostasis.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21269460 2011 Initial characterization of the human central proteome.
20490454 2010 DDOST, PRKCSH and LGALS3, which encode AGE-receptors 1, 2 and 3, respectively, are not associated with diabetic nephropathy in type 1 diabetes.
19955485 2010 AGER1 regulates endothelial cell NADPH oxidase-dependent oxidant stress via PKC-delta: implications for vascular disease.
19946888 2010 Defining the membrane proteome of NK cells.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15835887 2005 Proteomic analysis of mammalian oligosaccharyltransferase reveals multiple subcomplexes that contain Sec61, TRAP, and two potential new subunits.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15289604 2004 Advanced glycation endproduct (AGE) receptor 1 is a negative regulator of the inflammatory response to AGE in mesangial cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10080935 1999 Characterization of the advanced glycation end-product receptor complex in human vascular endothelial cells.
9642163 1998 Interleukin-2 induces N-glycosylation in T-cells: characterization of human lymphocyte oligosaccharyltransferase.
9367678 1997 Genome organization of human 48-kDa oligosaccharyltransferase (DDOST).
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.
7625827 1995 Human oligosaccharyltransferase: isolation, characterization, and the complete amino acid sequence of 50-kDa subunit.