Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.33
PubTator Score 6.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 2.102 2.0e-02
posterior fossa group A ependymoma 1.800 6.8e-07
adrenocortical carcinoma 1.660 5.0e-02
cystic fibrosis 3.100 7.7e-04
subependymal giant cell astrocytoma 3.312 2.9e-02
Alzheimer's disease 1.100 4.0e-02
Pick disease 1.800 9.2e-03
progressive supranuclear palsy 1.100 7.5e-03
invasive ductal carcinoma -1.200 2.1e-03
pituitary cancer 3.600 1.5e-07

Synonym

Accession Q96D03 B2R7C3
Symbols REDD2
Rtp801L

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
19491193 Promoter methylation and differential gene expression of five markers: COL1A2, NPM2, HSPB6, DDIT4L and MT1G were validated by sequencing of bisulfite-modified DNA and real-time reverse transcriptase PCR, respectively.
19268525 mediates monocyte cell death through a reduction in thioredoxin-1 expression
15632201 RTP801 and RTP801L work downstream of AKT and upstream of TSC2 to inhibit mTOR functions

AA Sequence

MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQ      1 - 70
TKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVF     71 - 140
KQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS                     141 - 193
//

Text Mined References (15)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
19491193 2009 Genome-wide screen of promoter methylation identifies novel markers in melanoma.
19268525 2009 The regulated in development and DNA damage response 2 (REDD2) gene mediates human monocyte cell death through a reduction in thioredoxin-1 expression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15632201 2005 The stress-inducted proteins RTP801 and RTP801L are negative regulators of the mammalian target of rapamycin pathway.
15545625 2004 Regulation of mTOR function in response to hypoxia by REDD1 and the TSC1/TSC2 tumor suppressor complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308555 2004 REDD2 gene is upregulated by modified LDL or hypoxia and mediates human macrophage cell death.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453409 2002 REDD1, a developmentally regulated transcriptional target of p63 and p53, links p63 to regulation of reactive oxygen species.