Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.72
PubTator Score 6.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Mature teratoma 3 3.548 1.8
Germinoma 3 3.505 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 1.660 5.0e-02
Alzheimer's disease 1.100 4.0e-02
cystic fibrosis 3.100 7.7e-04
ependymoma 1.500 9.7e-04
invasive ductal carcinoma -1.200 2.1e-03
osteosarcoma 2.102 2.0e-02
Pick disease 1.800 9.2e-03
pituitary cancer 3.600 1.5e-07
progressive supranuclear palsy 1.100 7.5e-03
subependymal giant cell astrocytoma 3.312 2.9e-02

Gene RIF (3)

AA Sequence

MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQ      1 - 70
TKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVF     71 - 140
KQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS                     141 - 193
//

Text Mined References (16)

PMID Year Title