Property Summary

NCBI Gene PubMed Count 56
PubMed Score 134.66
PubTator Score 71.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis 2.300 4.8e-02
ependymoma 2.200 3.5e-02
astrocytoma 1.800 8.0e-23
glioblastoma multiforme 1.700 1.9e-24
oligodendroglioma 1.800 5.6e-20
chronic lymphosyte leukemia -1.600 7.6e-07
cystic fibrosis 1.166 3.2e-04
juvenile dermatomyositis 1.044 6.3e-05
acute quadriplegic myopathy 1.280 1.1e-02
tuberculosis and treatment for 3 months -2.100 3.2e-04
non-small cell lung cancer 1.206 3.0e-10
intraductal papillary-mucinous adenoma (... -2.300 3.2e-04
intraductal papillary-mucinous carcinoma... -2.500 1.2e-03
colon cancer 1.300 1.2e-02
active Crohn's disease 1.355 3.8e-02
active ulcerative colitis 3.315 2.9e-03
lung adenocarcinoma -1.100 1.4e-03
psoriasis -1.500 1.5e-06
ovarian cancer 3.400 3.7e-07
Down syndrome 1.600 2.9e-02

Gene RIF (43)

PMID Text
26968249 C/EBPbeta promotes autophagy in PC3 cells by augmenting REDD1 expression.
26487002 These data highlight the central role of REDD1 in regulating both protein synthesis and autophagy in skeletal muscle during sepsis.
26269521 Findings from this study propose a REDD1-regulated mechanism in T2D skeletal muscle that may contribute to whole body insulin resistance and may be a target to improve insulin action in insulin-resistant individuals.
25504525 REDD1 knockout (KO) mice, all skin compartments, epidermal stem, and progenitor cells were protected from atrophic effects of glucocorticoids.
25337238 REDD1 and p-AKT over-expression may serve as a prognostic biomarker in ovarian cancer, but KRAS mutations and REDD1 protein over-expression were not correlated in OC.
25255219 MiR-630 reduced apoptosis by downregulating several apoptotic modulators, PARP3, DDIT4, and EP300.
25147182 analysis of ubiquitin-mediated proteolysis of DNA damage-inducible transcript 4 (DDIT4) by the E3 ligase HUWE1
25058423 Caspase 3 cleaved REDD1 during apoptotic activation.
25056877 the results demonstrate that REDD1 acts not only as a repressor of mTORC1 but also as a constant modulator of the phosphorylation of Akt in response to growth factors and nutrients.
24728411 these postmortem and preclinical findings identify REDD1 as a critical mediator of the atrophy of neurons and depressive behavior caused by chronic stress exposure
24338366 Translocation to the plasma membrane appears to be an inactivation mechanism of REDD1 by G-protein coupled receptors.
23717519 mTORC1 regulates REDD1 protein stability in a 26S proteasome dependent manner.
23528835 The sustained overexpression of Redd1 leads to mTORC1 inhibition and to consequent Akt activation that is involved in cell survival.
23193052 An immobilization-induced attenuation of mTORC1 signaling mediated by induction of REDD1/2 and defective p70S6K1 phosphorylation.
22527987 REDD1 expression plays a role in maintaining normal function of placenta, while the increase of REDD1 is related to the pathogenesis of pre-eclampsia.
21909097 REDD1 is a new host defense factor, and chemical activation of REDD1 expression represents a potent antiviral intervention strategy
21798997 mechanisms have evolved in tumors to escape growth suppressive signals resulting from VHL loss and REDD1 upregulation
21540236 Metformin increases REDD1 expression in a p53-dependent manner. REDD1 invalidation, using siRNA or REDD1(-/-) cells, abrogates metformin inhibition of mTOR.
21460850 these results collectively demonstrate that TXNIP stabilizes Redd1 protein induced by ATF4 in response to 2-DG, resulting in potentiation of mTOR suppression.
21414293 these results provide preliminary evidence that Redd1 inhibits the invasive activity of NSCLC cells via suppression of the mTOR downstream pathway.
21266827 In the HER2 overexpression type and triple-negative breast carcer, tumor cell proliferation and survival in the hypoxic tumor environment could possibly be due to disinhibition of the mTOR pathway and HIF-1alpha stabilization by downregulation of REDD1.
21258409 Data show that miR-495 expression was directly modulated by transcription factor E12/E47, and promotes oncogenesis via downregulation of E-cadherin and REDD1.
21123297 DDIT4, an inhibitor of mTOR signaling, is a direct target for 1,25(OH)(2)D(3) and VDRE-BP, and functions to suppress cell proliferation in response to vitamin D
20473305 Our data support the notion that Rtp801 may represent a major molecular sensor and mediator of cigarette smoke-induced lung injury.
20374513 that expression of RTP801 was lower in oral lichen planus than in controls
20354178 sertraline exerts antiproliferative activity by targeting the mTOR signaling pathway in a REDD1-dependent manner
20166753 Structure/function analyses have led us to identify two segments in REDD1 that are essential for mTORC1 inhibition.
19996311 Insulin induces REDD1 expression through hypoxia-inducible factor 1 activation in adipocytes.
19557001 REDD1 degradation is crucially required for the restoration of mTOR signalling as cells recover from hypoxic stress.
19221489 DNA-damage-inducible transcript 4 is a key mediator in RAS protein -mediated transformation through an effect on anti-apoptosis.
19210572 PKR represents a cognitive decline biomarker able to dysregulate translation via two consecutive targets p53 and Redd1 in Alzheimer disease lymphocytes
19127203 REDD1 expression in response to hypoxia and dexamethasone is cell-type specific and that physiologically appropriate levels of PO2 should be used when investigating fetal lung development.
19114033 The results suggest that REDD1 expression is upregulated during ER stress through a mechanism involving activation of PERK, phosphorylation of eIF2alpha, and increased ATF4 expression.
18953439 results suggest a novel mechanism by which AMPK activation after hypoxia-induced energy stress may be crucial in regulating REDD1 expression to control the mTOR pathway in head and neck squamous cell carcinoma
18796435 unique effect of inhibition of fatty-acid synthase results from negative regulation of the mTOR pathway via DDIT4
17307335 These results demonstrate that hypoxic condition-and high cell density-induced expression of Redd1 is mediated by coactivation of Sp1 and HIF-1alpha downstream of the PI3K/Akt signaling pathway.
17005863 The elevation of RTP801 we detect in PD substantia nigral neurons may mediate their degeneration.
16258273 Stress response gene REDD1 is identified in this review as an essential regulator of checkpoint kinase mTOR activity through the tuberous sclerosis tumor suppressors TSC1/2 complex.
15988001 REDD1 as a critical transducer of the cellular response to energy depletion through the TSC-mTOR pathway.
15632201 RTP801 and RTP801L work downstream of AKT and upstream of TSC2 to inhibit mTOR functions
15592522 REDD1 (RTP801) can act as a transcriptional downstream target of PI 3-kinase signaling in human prostate cancer cells.
15180327 co-transfection with antisense Sp1 oligonucleotide suggests that hypoxia induction of the RTP801 promoter is mediated by Sp1
14646594 RTP801 might play important roles in Abeta toxicity and the pathogenesis of Alzheimer's disease

AA Sequence

MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEEDT      1 - 70
AYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPC     71 - 140
GLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLFSSANSPFLPGFSQSLTL    141 - 210
STGFRVIKKKLYSSEQLLIEEC                                                    211 - 232
//

Text Mined References (63)

PMID Year Title
26968249 2016 C/EBP? regulates sensitivity to bortezomib in prostate cancer cells by inducing REDD1 and autophagosome-lysosome fusion.
26487002 2015 Disruption of REDD1 gene ameliorates sepsis-induced decrease in mTORC1 signaling but has divergent effects on proteolytic signaling in skeletal muscle.
26269521 2015 Aberrant REDD1-mTORC1 responses to insulin in skeletal muscle from Type 2 diabetics.
25504525 2014 REDD1 functions at the crossroads between the therapeutic and adverse effects of topical glucocorticoids.
25337238 2014 REDD1 and p-AKT over-expression may predict poor prognosis in ovarian cancer.
25255219 2014 MiR-630 inhibits proliferation by targeting CDC7 kinase, but maintains the apoptotic balance by targeting multiple modulators in human lung cancer A549 cells.
25147182 2014 Quantitative Lys-?-Gly-Gly (diGly) proteomics coupled with inducible RNAi reveals ubiquitin-mediated proteolysis of DNA damage-inducible transcript 4 (DDIT4) by the E3 ligase HUWE1.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
25058423 2014 A new posttranslational regulation of REDD1/DDIT4 through cleavage by caspase 3 modifies its cellular function.
25056877 2014 REDD1 enhances protein phosphatase 2A-mediated dephosphorylation of Akt to repress mTORC1 signaling.
24728411 2014 REDD1 is essential for stress-induced synaptic loss and depressive behavior.
24338366 2014 Plasma membrane translocation of REDD1 governed by GPCRs contributes to mTORC1 activation.
23717519 2013 mTORC1 dependent regulation of REDD1 protein stability.
23528835 2013 Sustained overexpression of Redd1 leads to Akt activation involved in cell survival.
23193052 2013 The mTORC1 signaling repressors REDD1/2 are rapidly induced and activation of p70S6K1 by leucine is defective in skeletal muscle of an immobilized rat hindlimb.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22527987 2012 REDD1 expression in placenta during human gestation.
21909097 2011 Chemical inhibition of RNA viruses reveals REDD1 as a host defense factor.
21798997 2011 Interplay between pVHL and mTORC1 pathways in clear-cell renal cell carcinoma.
21540236 2011 Metformin, independent of AMPK, induces mTOR inhibition and cell-cycle arrest through REDD1.
21460850 2011 TXNIP potentiates Redd1-induced mTOR suppression through stabilization of Redd1.
21414293 2011 Redd1 inhibits the invasiveness of non-small cell lung cancer cells.
21266827 2010 Alteration of REDD1-mediated mammalian target of rapamycin pathway and hypoxia-inducible factor-1? regulation in human breast cancer.
21258409 2011 miR-495 is upregulated by E12/E47 in breast cancer stem cells, and promotes oncogenesis and hypoxia resistance via downregulation of E-cadherin and REDD1.
21123297 2011 Gene targeting by the vitamin D response element binding protein reveals a role for vitamin D in osteoblast mTOR signaling.
20473305 2010 Rtp801, a suppressor of mTOR signaling, is an essential mediator of cigarette smoke-induced pulmonary injury and emphysema.
20374513 2010 Altered expression of mRNA for HIF-1alpha and its target genes RTP801 and VEGF in patients with oral lichen planus.
20354178 2010 The antidepressant sertraline inhibits translation initiation by curtailing mammalian target of rapamycin signaling.
20166753 2010 Structural analysis and functional implications of the negative mTORC1 regulator REDD1.
19996311 2010 Insulin induces REDD1 expression through hypoxia-inducible factor 1 activation in adipocytes.
19557001 2009 REDD1, an inhibitor of mTOR signalling, is regulated by the CUL4A-DDB1 ubiquitin ligase.
19221489 2009 REDD1 is required for RAS-mediated transformation of human ovarian epithelial cells.
19210572 2009 PKR, a cognitive decline biomarker, can regulate translation via two consecutive molecular targets p53 and Redd1 in lymphocytes of AD patients.
19127203 2009 Glucocorticoid-mediated repression of REDD1 mRNA expression in rat fetal distal lung epithelial cells.
19114033 2009 ATF4 is necessary and sufficient for ER stress-induced upregulation of REDD1 expression.
18953439 2008 Hypoxia-induced energy stress inhibits the mTOR pathway by activating an AMPK/REDD1 signaling axis in head and neck squamous cell carcinoma.
18796435 2008 Inhibition of fatty-acid synthase induces caspase-8-mediated tumor cell apoptosis by up-regulating DDIT4.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17379067 2007 RTP801 is a novel retinoic acid-responsive gene associated with myeloid differentiation.
17307335 2007 Hypoxic condition- and high cell density-induced expression of Redd1 is regulated by activation of hypoxia-inducible factor-1alpha and Sp1 through the phosphatidylinositol 3-kinase/Akt signaling pathway.
17005863 2006 RTP801 is elevated in Parkinson brain substantia nigral neurons and mediates death in cellular models of Parkinson's disease by a mechanism involving mammalian target of rapamycin inactivation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
16258273 2005 Growth control under stress: mTOR regulation through the REDD1-TSC pathway.
15988001 2005 Regulation of mTOR and cell growth in response to energy stress by REDD1.
15751966 2005 Induction of a cell stress response gene RTP801 by DNA damaging agent methyl methanesulfonate through CCAAT/enhancer binding protein.
15632201 2005 The stress-inducted proteins RTP801 and RTP801L are negative regulators of the mammalian target of rapamycin pathway.
15592522 2005 REDD1 integrates hypoxia-mediated survival signaling downstream of phosphatidylinositol 3-kinase.
15545625 2004 Regulation of mTOR function in response to hypoxia by REDD1 and the TSC1/TSC2 tumor suppressor complex.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15180327 2004 Sp1-dependent regulation of the RTP801 promoter and its application to hypoxia-inducible VEGF plasmid for ischemic disease.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14646594 2003 Identification of amyloid beta-peptide responsive genes by cDNA microarray technology: involvement of RTP801 in amyloid beta-peptide toxicity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453409 2002 REDD1, a developmentally regulated transcriptional target of p63 and p53, links p63 to regulation of reactive oxygen species.
11884613 2002 Identification of a novel hypoxia-inducible factor 1-responsive gene, RTP801, involved in apoptosis.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.