Property Summary

NCBI Gene PubMed Count 190
PubMed Score 671.78
PubTator Score 3183.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
hepatocellular carcinoma -1.400 6.3e-06
malignant mesothelioma 1.200 2.8e-05
medulloblastoma, large-cell -1.100 3.0e-04
lung cancer -1.500 1.2e-02
group 4 medulloblastoma -1.200 8.7e-04
non primary Sjogren syndrome sicca 1.200 2.0e-02
psoriasis -1.200 3.7e-11
acute myeloid leukemia 1.300 2.3e-03

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1357 screening 0 / 0 / 11 Determination of inhibition of thapsigargin-initiated CHOP protein induction in ER stress signaling.

Gene RIF (153)

PMID Text
26865464 FUS-DDIT3 is uniquely regulated at the transcriptional as well as the post-translational level and that its expression level is important for myxoid liposarcoma tumour development.
26504039 Up-regulation of CHOP is associated with Pancreatic Neuroendocrine Tumors.
26486079 Data show CGK733 induced microtubule associated protein LC3B formation upstream of AMP-activated protein kinase and protein kinase RNA-like endoplasmic reticulum kinase/CCAAT-enhancer-binding protein homologous protein pathways and p21 Cip1 expression.
26384350 Data suggest that HOXA-AS2 could be an oncogene for GC partly through suppressing P21, PLK3, and DDIT3 expression.
26259235 CGK733-induced intracellular calcium sequestration in pancreatic tumor cells is correlated with the PERK/CHOP signaling pathway and may also be involved in the dysregulations of calcium-binding proteins.
26174226 the C/EBPD binding site is required for RU486-mediated activation of the CHOP promoter.
26125799 Combined administration inhibited the cells most potently and time-dependently, decreased the expression of HO-1, and significantly increased the expression of ATF4, CHOP, and Ire-1 proteins expression levels
26090483 Blockage of PERK signaling expression by siRNA not only significantly reduced the expression of CHOP.
25770212 DDIT3 and KAT2A cooperatively up-regulate TNFRSF10A and TNFRSF10B.
25643991 These data show that altered/impaired expression of mtDNA induces CHOP-10 expression in a signaling pathway that depends on the eIF2alpha/ATF4 axis of the integrated stress response rather than on the mitochondrial unfolded protein response.
25532011 Letter/Case Report: DDIT3 gene amplification in primary gallbladder myxoid liposarcoma.
25387528 Data suggest that expression of CHOP (c/EBP-homologous protein) and ERO1alpha (oxidoreductin-1-L-alpha) is up-regulated in liver of patients with acute liver failure.
25343248 knockdown of a proton-sensing G protein-coupled receptor GPR4 markedly reduced CHOP expression and endothelial cell apoptosis after hypoxia exposure.
25270224 Data indicate that Tanshinone IIA (Tan-IIA)T upregulated the protein expression of CHOP and Bax, but downregulated the protein expression of BiP, TCTP, Mcl-1 and Bcl-xL.
25192658 Data show that oroxylin A inhibits the all-trans-Retinoic Acid (ATRA)-induced IL-6 production via downregulating transcription factor CHOP in leukemia cell lines, suggesting a therapeutic strategy for retinoic acid syndrome (RAS).
25032846 CHOP is critical for mediating ASPP2-induced autophagic apoptosis by decreasing Bcl-2 expression and maintaining nuclear ASPP2-Bcl-2 complexes.
24994112 TLR7 played an important role in macrophage apoptosis and cytokine secretion through the CHOP-dependent pathway.
24990631 This study reveals novel molecular events underlying the regulation of DDIT3 protein homeostasis and provides insight in understanding the relationship between SPOP mutations and ER stress dysregulation in prostate cancer.
24963104 crucial role in pathogenesis of chronic kidney disease-dependent vascular calcification
24781973 In a GRP78-positive breast cancer subset, CHOP overexpression correlated with a lower risk of recurrence.
24738922 DDIT3 overexpression increased their calcium nodule formation and expression of OSX, DSPP, DMP1 and OCN but reduced Human dental pulp cell proliferation.
24625971 Suggest that dimethoxycurcumin triggers a stronger proteasome inhibition and higher induction of CHOP compared with curcumin, giving it more potent anticancer effects on malignant breast cancer cells.
24598693 Androgen receptor degradation by Rosemary Extract is dependent on CHOP/GADD153.
24565834 Knockdown of IRE1a and CHOP inhibited ER stress-induced autophagy in colon cancer cells.
24367283 Thus, further investigation of the pro- and antioncogenic functions of CHOP is likely to reveal important new insights into the pathogenesis of liver cancer and other tumor types
24367269 They implicate CHOP as a common contributing factor in the development of HCC in a variety of chronic liver diseases.
24351550 CHOP mediates chondrocyte catabolic and apoptotic responses
24339898 a role for CHOP as a positive regulator of carcinogen-induced HCC progression
24287694 pharmacological inhibition of ChoKalpha induces cancer cell death through a mechanism that involves the activation of exaggerated and persistent ER stress supported by CHOP overproduction.
24285420 this study for the first time provided substantial evidence for the FUS-CHOP oncoprotein as an inducer of metastasis that is due to the transcriptional induction of specific tumor-associated proteases.
24270407 Findings demonstrate that CypB prevents hypoxia-induced cell death through modulation of ubiquitin-mediated CHOP protein degradation, suggesting that CypB may have an important role in the tight regulation of CHOP under hypoxia.
24078627 azadirone can sensitize cancer cells to TRAIL through ROS-ERK-CHOP-mediated up-regulation of DR5 and DR4 signaling, down-regulation of cell survival proteins, and up-regulation of proapoptotic proteins.
24060278 Increased GADD153 expression is associated with salivary gland inflammation in Sjogren syndrome.
23836491 FUS-CHOP, a hallmark fusion gene in mixoid liposarcoma, has an instructive role in cell lineage commitment.
23749468 CHOP-mediated hepcidin suppression modulates hepatic iron load.
23546223 These data suggest that ER stress-mediated CHOP induction is involved in pronounced cytotoxicity
23412101 High CHOP expression is associated with malignant mesothelioma.
23339468 GADD153 regulates Bak expression by its binding to promoter region (between -3,398 and -3,380).
23065795 pJNK2, CHOP, and DR5 are upregulated by gamma-tocopherol in breast cancer cell lines.
23053497 DR5 upregulation in this case is mediated by C/EBP homology protein (CHOP), an important endoplasmic reticulum stress responsive protein.
22995304 these results suggest a novel essential molecular mechanism that TLS-CHOP activates PAI-1 expression by repression of miR-486 expression in myxoid liposarcoma tumorigenesis and development.
22815481 cIAP1 plays a critical role in beta-cell survival under endoplasmic reticulum stress: by promoting ubiquitination and degradation of C/EBP homologous protein (CHOP)
22800509 lipocalin 2 is a new GADD153 target gene that mediates endoplasmic reticulum stress-induced apoptosis in lung cancer cells
22753273 CHOP increased cFLIPL protein instability and promoted ubiquitin/proteasome-mediated cFLIPL degradation.
22691366 ATF4 and Nrf2 can control CHOP induction in thyroid cancer cells by proteasome inhibition.
22669460 CHOP is one of the key downstream molecules known to be involved in ERS-mediated apoptosis
22609407 By using mutated reporter constructs of the CHOP promoter, it turned out that the amino acid response element (AARE) is the most prominent element for CHOP induction after CK2 inhibition.
22570737 This study elucidates the molecular mechanisms underlying EWSR1-DDIT3 fusion protein-mediated phenotypic selection of putative target multipotent mesenchymal cells during myxoid liposarcoma development.
22496840 These results suggested a potential regulatory function of L-cysteine which may lead to changes in global conformation of CHOP in response to the cellular redox state and/or endoplasmic reticulum stress.
22289049 the upregulation of CHOP contributes to the enhancing effect of melatonin plus TG on apoptosis in cancer cells.
22261448 The diagnosis of myxoid liposarcoma was confirmed by fluorescence in situ hybridization studies for DDIT3 (also known as CHOP) rearrangement.
22246806 Saturated fatty acid-induced ER stress and apoptosis in these human liver cells were enacted through the PERK/ATF4/CHOP signaling pathway.
22157935 DDIT3, STT3A, ARG2 and FAM129A immunohistochemistry does not appear to be useful in the diagnosis of thyroid follicular neoplasias, as they do not reliably distinguish follicular thyroid carcinoma from follicular thyroid adenoma.
22146569 Increased expression of Endoplasmic Reticulum (ER) stress markers, GRP78, ATF6 and CHOP, in endometrioid endometrial carcinomas suggests a role for ER stress in endometrial cancer.
22096849 Cadmium chloride can induce DNA damage and increase expression levels of the gadd153 and gadd45beta promoters in HepG2 cells.
21966512 Study we found that HEV ORF2 activates the expression of CHOP. ORF2 stimulates the CHOP promoter mainly through amino acid response elements and to a minor extent endoplasmic reticulum stress response elements.
21801305 Salermide induces expression of ATF4, and ATF4 up-regulates ATF3 and subsequently modulates CHOP which leads to apoptosis in human cancer cells.
21741997 C/EBP zeta overexpression downregulated NGAL to inhibit migration and invasion of breast cancer.
21732477 FUS-CHOP expression in a p53-deficient background is sufficient to initiate liposarcoma in mouse but not in human ASCs, suggesting the need of additional cooperating mutations in hASCs.
21700680 BRCA1 targets GADD153 promoter to increase its transcription in response to DNA damage.
21697995 A trend increase in CHOP levels appear in multiple human lung cell types following acute cigarette smoke exposure in vitro.
21697087 Modulation of CCAAT/enhancer binding protein homologous protein (CHOP)-dependent DR5 expression by nelfinavir sensitizes glioblastoma multiforme cells to tumor necrosis factor-related apoptosis-inducing ligand (TRAIL).
21479362 GRP78, CHOP, caspase 4, and caspase 3 may be involved in adenosine-induced HepG2 cell apoptosis
21471847 CHOP may be involved in mediating PGE2-induced IL-8 activation in astrocytomas
21402790 Data implicate miR-708 in the homeostatic regulation of ER function in mammalian rod photoreceptors, whereby miR-708 may help prevent an excessive rhodopsin load from entering the ER.
21365646 involvement of alpha fetoprotein in retinoic acid receptor-mediated expression and biological effects of GADD153.
21189163 increased levels of mRNA for Gadd153 gene were detected after 1 h ischemia and 1 h reperfusion in small intestine
21179554 stearoyl-CoA desaturase 1 inhibition induces CHOP-dependent cell death in human cancer cells
21044953 small molecules such as celecoxib induce DR5 expression through activating ERK/RSK signaling and subsequent Elk1 activation and ATF4-dependent CHOP induction
20889551 CHOP and PPARgamma may represent critical mechanistic links between ribotoxic stress and proinflammatory cytokine production
20876114 Endoplasmic reticulum stress-induced transcription factor, CHOP, is crucial for dendritic cell IL-23 expression.
20829347 Data show that ER stress can enhance proinflammatory NF-kappaB activation due to the CHOP-mediated regulation of PPARgamma action.
20554776 Coxsackievirus B3 infection induces apoptosis through downregulation of p58IPK and activation of CHOP and SREBP1.
20492726 Aberrant methylation of DDIT3 is associated with chronic myeloid leukemia.
20430872 Collectively, these data suggest that CHOP and AP-1(c-Jun) cooperatively mediate PUMA induction during hepatocyte lipoapoptosis.
20424162 Data show that knocking down CHOP by RNA interference protects beta cells from IL-1beta-induced apoptosis, providing direct mechanistic links between cytokine-induced signaling pathways and CHOP-mediated apoptosis of beta cells.
20122151 Autophagy induction and CHOP under-expression increases cell resistance against endoplasmic reticulum stress-induced cell death in fibroblasts from rheumatoid arthritis patients.
20116099 Aberrant methylation of DNA-damage-inducible transcript 3 promoter is associated with myelodysplastic syndrome.
20032083 The hCHOP-C/EBPalpha complex down-regulates SLC29A1 expression in an NO-dependent manner in vascular endothelial cells from gestational diabetes
20017906 FUS-DDIT3 and the normal DDIT3 bind CDK2.
19855386 found that CHOP expression induced by ER stress was suppressed by prior engagement of toll-like receptor (TLR) 3 or 4 through a TRIF-dependent pathway.
19744850 Evidence from myelinating cells in the central and peripheral nervous systems indicates that CHOP can no longer be viewed as a proapoptotic transcription factor.
19733664 These results indicate that the up-regulation of CHOP in motor neurons and glial cells may play pivotal roles in the pathogenesis of amyotrophic lateral sclerosis
19723703 Mechanistically, regulation of ER-stress-induced apoptosis by CerS6/C(16)-ceramide was linked to the activation of a specific arm, ATF6/CHOP, of the unfolded protein response pathway.
19722195 Data show that GRP78 was upregulated following treatment with NAC or PEN, and both the ATF6 protein and XBP1 mRNA were processed, which facilitates the expression of C/EBP homologous protein CHOP.
19672300 we show that immediately after stressing the ER, the stress-inducible transcription factor CHOP depletes C/EBPalpha protein pool, which may in turn impact on the activation of hepcidin transcription
19558691 CHOP 5'UTR-c.279T>C and +nt30C>T variants are not associated with overweight condition or with tumors/cancer
19558691 Observational study of gene-disease association. (HuGE Navigator)
19470730 The formation of the spliced variant of XBP1s was detectable in 16.2% of AML patients, and consistent with activated unfolded protein response, thess patients also had significantly increased expression of calreticulin, GRP78, and CHOP.
19116245 Two CCAAT/enhancer-binding protein (C/EBP) family members [C/EBP-homologous protein (CHOP) and C/EBPbeta] enhanced V2 transcription via different pathways.
19107326 Up regulation of GADD-153, GRP-78, with more pronounced expression in proliferative glomerulonephritis(GN) vs. nonproliferative GN and down regulation of Bcl-2 proteins was observed in the GN as compared to minimal change disease
19037087 Rottlerin-induced DR5 upregulation is accompanied by CCAAT/enhancer-binding protein-homologous protein (CHOP) protein expression and may offer a new therapeutic strategy against cancer.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18940792 CHOP is a member of the transcription factor network that controls the stress-induced regulation of specific C/EBP-ATF4-containing genes, such as ASNS
18850010 The FUS-DDIT3 protein induces increased expression of the CAAT/enhancer-binding protein (C/EBP) and nuclear factor-kappaB (NF-kappaB)-controlled gene IL8, and the N-terminal FUS part is required for this activation.
18772138 the increased expression of CHOP in response to PGE(2) exerts a positive transcriptional regulation of the IL-8 promoter mediated by direct binding to a novel consensus site
18680108 Cnclude that the CHOP T/C and C/T haplotype contributes to our diabetes mellitus type 2 linkage signal on chromosome 12q13.1.
18680108 Observational study of gene-disease association. (HuGE Navigator)
18679584 CHOP is up-regulated by brefeldin A, it is not a major mediator of brefeldin A-induced apoptosis.
18593935 CHOP-dependent DR5 up-regulation is a key event mediating SHetA2-induced apoptosis.
18541659 These results suggest that Stx2-induced apoptosis is mediated by CHOP in human brain microvascular endothelial cells (HBMEC) and involves activation of both the intrinsic and extrinsic pathways of apoptosis.
18534616 Data report a novel mechanistic role of CHOP in the inhibition of Wnt/TCF signaling and stimulation of c-Jun and sucrase-isomaltase reporter activity in intestinal colon cancer cells.
18396163 CHOP transcription by JDP2 following amino acid starvation was investigated.
18394432 oxidative stress-independent induction of GRP78 counterbalances the proapoptotic action of CHOP
18278507 tert-butyl hydroperoxide (tBH)increases oxidative stress, increases accumulation of ROS in the ER, and upregulates expression of GRP-78 and GADD153.
17968315 Celecoxib and a novel COX-2 inhibitor ON09310 upregulate death receptor 5 expression via GADD153/CHOP
17872950 the N-terminal portion of CHOP plays a crucial role in its functional regulation and enable us to identify a novel function of TRB3 as an intracellular antagonist of the p300-binding domain of CHOP.
17709599 PGE-2 stimulates IL-8 production through the CHOP transcription factor in cystic fibrosis cells
17686866 expression of WNV nonstructural proteins alone was sufficient to induce CHOP expression
17652152 GADD153 plays a role in asoprisnil-induced apoptosis.
17647282 A single tumor carrying a t(12;22) translocation expressed a hitherto unknown EWSR1-DDIT3 fusion transcript (13-3) linking the complete RNA-binding domain of EWSR1 with a short piece of the 5'-UTR
17620318 Results identify in Italians a suggestive linkage of early-onset type 2 diabetes (T2D) to chromosome 12q15, in the region of the CHOP gene, but no link to C/EBPbeta.
17616685 GADD153 (CHOP) and Bcl-2-binding component 3 (PUMA) and apoptosis are induced by 4-hydroxybenzylretinone in a process that is caspase- dependent and independent of the retinoic acid receptor
17601350 Observational study of gene-disease association. (HuGE Navigator)
17513780 A switch between C/enhancer-binding protein (CEBP) zeta and CEBP beta operates at the CEBP site on the C-reactive protein (CRP)promoter to regulate CRP transcription.
17468515 FUS-DDIT3 is a chimeric oncogene generated by the most common chromosomal translocation t(12;16)(q13;p11) associated to liposarcomas.
17276738 results suggest that the presence of MELAS and NARP mtDNA mutations elicits upregulation of CHOP and ASNS genes through the elevation of ATF4 expression and its binding to the amino acid regulatory element and nutrient-sensing response element-1
17273769 DR5/TRAIL-R2 expression is upregulated by fenretinide via the induction of the transcription factor CHOP
17171638 Findings suggest that a regulatory thiol redox-sensitive signaling cascade exists in the molecular pathway leading to induction of GADD153 expression by curcumin.
16942595 hypoglycaemia-induced necrotic cell death of neuroblastoma cells is an active process mediated via the induction of the transcription factor CHOP
16651630 The fusion oncogene FUS-DDIT3 and the normal DDIT3 induce a liposarcoma phenotype when expressed in a primitive sarcoma cell line.
16511829 Expression of Rad51 enhances basal- and HIV-1 Tat-induced transcription of the HIV-1 LTR promoter; this event requires cooperativity from the C/EBP family of transcription factors including C/EBPbeta and C/EBPbeta homologous protein (CHOP)
16463383 Upregulation of GADD153 is a key requirement for cancer prevention in combination with EGCG.
16098044 CHOP participates in adaptive responses of the epidermis following UVB/UVA exposure in vivo
16005964 insufficient dosage of C/EBPzeta might be involved in the development of leukemia
15917187 data provide the first evidence that the posttranscriptional expression of the Gadd153 gene can be regulated by ROS produced by All-trans-N-(4-hydroxyphenyl)retinamide
15870698 oncogenic Ras-mediated cellular transformation also involves downmodulation of important molecules such as Gadd153 that negatively regulate cell growth and survival
15688424 Effect of FUS-DDIT3 fusion on IL6 expression is C/EBP beta dependent in myxoid lipoxarcoma.
15659384 Prostaglandin E2 induces interleukin-8 gene transcription by activating C/EBP homologous protein in human T lymphocytes
15327748 Results indicate that PKC, especially PKCdelta, plays an important role in the induction of GADD153 mRNA following oxidative stress.
15316935 deoxycholate-induced upregulation of GADD153 mRNA expression occurred at the level of transcription without involving reactive oxygen species and MAPK signaling
15308577 Retinoic acid signaling in granulocytic differentiation involves regulated expression of CHOP and C/EBPepsilon in a coordinated fashion.
15286712 data suggest that different FUS/CHOP variants cause transformation of mesenchymal cells via the same pathways with comparable efficacy
15277326 CRP induced an increase of GADD153 mRNA expression. CRP regulation of GADD153 in VSMCs occurs at the posttranscriptional level by mRNA stabilization. GADD153 colocalized to apoptotic VSMCs in coronary lesions, supporting a role in CRP-induced cell death.
15271854 GADD153 protein was detected before the appearance of apoptotic features in colon cancer cells, which raises the possibility that GADD153 protein might be important for curcumin-induced apoptosis.
15053923 Depriving cells of iron increased mRNA expression of GADD153 at the level of transcription rather than mRNA stability; neither reactive oxygen species nor DNA damage was involved in triggering GADD153 gene activation
15001576 AP1 and CHOP are induced by MEKK3 and have roles in TRAF7-related apoptosis
14685163 One of the components of the Endoplasmic reticulum stress-mediated apoptosis pathway is C/EBP homologous protein (CHOP), also known as growth arrest- and DNA damage-inducible gene 153 (GADD153).
14669326 Oil A induces apoptosis of pancreatic cancer cells via activating caspase cascade, modifying cell cycle progress and changing cell cycle-regulating proteins and GADD expression.
14635187 These findings suggest that phenethylisothiocyanate creates an oxidative cellular environment that induces DNA damage and GADD153, 34 and 45 gene activation, which in turn helps trigger apoptosis
14630918 CHOP expression induction by amino acid limitation requires both ATF4 expression and ATF2 phosphorylation
12939601 Transferrin and other target genes identified may play a functional role in the downstream pathway of GADD153.
12876286 CK2-mediated phosphorylation of CHOP inhibits its transcriptional activity
12706815 CHOP up-regulates IL-6 transcription by trapping negative regulating NF-IL6 isoform.
12618752 CHOP (C/EBPzeta)is constitutively multiubiquitinated & degraded by the proteasome. Ubiquitination and degradation are suppressed by forming dimers through the leucine zipper domains.
12297725 This nuclear transcription factor triggers down-regulation of TFF expression in human stomach neoplasm cells cultivated in vitro.
12168790 GADD 153 may play an important role in melanoma progression
12138118 These results suggest that GADD153 overexpression induced by N-(4-hydroxyphenyl)retinamide(4HPR) may contribute to the anticancer effects (induction of apoptosis and growth arrest) of 4HPR on cancer cells.
12097650 Genomic sequences necessary for transcriptional activation by amino acid deprivation of mammalian cells. chop expression is associated with cell stress and apoptosis.
12082616 HRG stimulation of mammary epithelial cells induces the expression of GADD153 mRNA and protein and transcription of GADD153 promoter.
12069855 expression mediated by AP-1 and C-EBP is involved in deoxycholic acid-induced apoptosis
11948400 Activation of peroxisome proliferator-activated receptor-gamma stimulates the growth arrest and DNA-damage inducible 153 gene in non-small cell lung carcinoma cells
11805088 Nitric oxide-induced apoptosis in RAW 264.7 macrophages is mediated by endoplasmic reticulum stress pathway involving ATF6 and CHOP

AA Sequence

MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEP      1 - 70
AEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENER     71 - 140
LKQEIERLTREVEATRRALIDRMVNLHQA                                             141 - 169
//

Text Mined References (193)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26865464 2016 Regulatory mechanisms, expression levels and proliferation effects of the FUS-DDIT3 fusion oncogene in liposarcoma.
26504039 2015 Endoplasmic Reticulum Stress in Pancreatic Neuroendocrine Tumors is Linked to Clinicopathological Parameters and Possible Epigenetic Regulations.
26486079 2015 CGK733-induced LC3 II formation is positively associated with the expression of cyclin-dependent kinase inhibitor p21Waf1/Cip1 through modulation of the AMPK and PERK/CHOP signaling pathways.
26384350 2015 Long noncoding RNA HOXA-AS2 promotes gastric cancer proliferation by epigenetically silencing P21/PLK3/DDIT3 expression.
26259235 2015 PERK/CHOP contributes to the CGK733-induced vesicular calcium sequestration which is accompanied by non-apoptotic cell death.
26174226 2016 RU486 Induces Pro-Apoptotic Endoplasmic Reticulum Stress Through the Induction of CHOP Expression by Enhancing C/EBP? Expression in Human Renal Carcinoma Caki Cells.
26125799 2015 Proapoptotic effects of heme oxygenase-1 inhibitor on Kasumi-1 cells via the ATF4/CHOP/Ire-1? pathway.
26090483 2015 Induction of Apoptosis Coupled to Endoplasmic Reticulum Stress through Regulation of CHOP and JNK in Bone Marrow Mesenchymal Stem Cells from Patients with Systemic Lupus Erythematosus.
25770212 2015 DDIT3 and KAT2A Proteins Regulate TNFRSF10A and TNFRSF10B Expression in Endoplasmic Reticulum Stress-mediated Apoptosis in Human Lung Cancer Cells.
25643991 2015 Inhibition of mitochondrial genome expression triggers the activation of CHOP-10 by a cell signaling dependent on the integrated stress response but not the mitochondrial unfolded protein response.
25532011 2014 An extremely rare primary gallbladder myxoid liposarcoma associated with amplification of DDIT3 gene.
25416956 2014 A proteome-scale map of the human interactome network.
25387528 2015 C/EBP homologous protein (CHOP) contributes to hepatocyte death via the promotion of ERO1? signalling in acute liver failure.
25343248 2014 Ischemia/reperfusion-induced CHOP expression promotes apoptosis and impairs renal function recovery: the role of acidosis and GPR4.
25270224 2014 Tanshinone IIA inhibits human gastric carcinoma AGS cell growth by decreasing BiP, TCTP, Mcl?1 and Bcl?xL and increasing Bax and CHOP protein expression.
25192658 2014 Oroxylin A inhibits ATRA-induced IL-6 expression involved in retinoic acid syndrome by down-regulating CHOP.
25032846 2014 CHOP mediates ASPP2-induced autophagic apoptosis in hepatoma cells by releasing Beclin-1 from Bcl-2 and inducing nuclear translocation of Bcl-2.
24994112 2014 Toll-like receptor 7 promotes the apoptosis of THP-1-derived macrophages through the CHOP-dependent pathway.
24990631 2014 Destruction of DDIT3/CHOP protein by wild-type SPOP but not prostate cancer-associated mutants.
24963104 2014 Endoplasmic reticulum stress effector CCAAT/enhancer-binding protein homologous protein (CHOP) regulates chronic kidney disease-induced vascular calcification.
24939851 2014 Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib.
24781973 2014 The endoplasmic reticulum stress markers GRP78 and CHOP predict disease-free survival and responsiveness to chemotherapy in breast cancer.
24738922 2014 DDIT3 overexpression increases odontoblastic potential of human dental pulp cells.
24625971 2014 Stronger proteasomal inhibition and higher CHOP induction are responsible for more effective induction of paraptosis by dimethoxycurcumin than curcumin.
24598693 2014 Rosemary (Rosmarinus officinalis) extract modulates CHOP/GADD153 to promote androgen receptor degradation and decreases xenograft tumor growth.
24565834 2014 Modulation of endoplasmic reticulum (ER) stress-induced autophagy by C/EBP homologous protein (CHOP) and inositol-requiring enzyme 1? (IRE1?) in human colon cancer cells.
24367283 2013 Stressing the importance of CHOP in liver cancer.
24367269 2013 The stress-regulated transcription factor CHOP promotes hepatic inflammatory gene expression, fibrosis, and oncogenesis.
24351550 2013 C/EBP homologous protein drives pro-catabolic responses in chondrocytes.
24339898 2013 CCAAT/enhancer-binding protein homologous (CHOP) protein promotes carcinogenesis in the DEN-induced hepatocellular carcinoma model.
24287694 2013 Choline kinase inhibition induces exacerbated endoplasmic reticulum stress and triggers apoptosis via CHOP in cancer cells.
24285420 2014 A mechanistic study on the metastasis inducing function of FUS-CHOP fusion protein in liposarcoma.
24270407 2014 Cyclophilin B is involved in p300-mediated degradation of CHOP in tumor cell adaptation to hypoxia.
24078627 2013 Azadirone, a limonoid tetranortriterpene, induces death receptors and sensitizes human cancer cells to tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) through a p53 protein-independent mechanism: evidence for the role of the ROS-ERK-CHOP-death receptor pathway.
24060278 2013 Reciprocal relation between GADD153 and Del-1 in regulation of salivary gland inflammation in Sjögren syndrome.
23836491 2013 Expression of FUS-CHOP fusion protein in immortalized/transformed human mesenchymal stem cells drives mixoid liposarcoma formation.
23749468 2013 CHOP-mediated hepcidin suppression modulates hepatic iron load.
23546223 2013 Macrolide antibiotics block autophagy flux and sensitize to bortezomib via endoplasmic reticulum stress-mediated CHOP induction in myeloma cells.
23412101 2013 The endoplasmic reticulum stress marker CHOP predicts survival in malignant mesothelioma.
23339468 2013 Cadmium induces neuronal cell death through reactive oxygen species activated by GADD153.
23065795 2012 Involvement of de novo ceramide synthesis in gamma-tocopherol and gamma-tocotrienol-induced apoptosis in human breast cancer cells.
23053497 2013 Sensitization of TRAIL-induced cell death by 20(S)-ginsenoside Rg3 via CHOP-mediated DR5 upregulation in human hepatocellular carcinoma cells.
22995304 2012 TLS-CHOP represses miR-486 expression, inducing upregulation of a metastasis regulator PAI-1 in human myxoid liposarcoma.
22934019 2012 The endoplasmic reticulum stress response in aging and age-related diseases.
22815481 2012 Cellular inhibitor of apoptosis protein-1 (cIAP1) plays a critical role in ?-cell survival under endoplasmic reticulum stress: promoting ubiquitination and degradation of C/EBP homologous protein (CHOP).
22800509 2012 Lipocalin 2, a new GADD153 target gene, as an apoptosis inducer of endoplasmic reticulum stress in lung cancer cells.
22761832 2012 CHOP potentially co-operates with FOXO3a in neuronal cells to regulate PUMA and BIM expression in response to ER stress.
22753273 2012 CHOP down-regulates cFLIP(L) expression by promoting ubiquitin/proteasome-mediated cFLIP(L) degradation.
22691366 2012 Implication of Nrf2 and ATF4 in differential induction of CHOP by proteasome inhibition in thyroid cancer cells.
22669460 2012 XBP1S protects cells from ER stress-induced apoptosis through Erk1/2 signaling pathway involving CHOP.
22609407 2012 CK2 regulates ATF4 and CHOP transcription within the cellular stress response signalling pathway.
22570737 2012 Myxoid liposarcoma-associated EWSR1-DDIT3 selectively represses osteoblastic and chondrocytic transcription in multipotent mesenchymal cells.
22496840 2012 Free cysteine modulates the conformation of human C/EBP homologous protein.
22496745 2012 Distinct cytoplasmic and nuclear functions of the stress induced protein DDIT3/CHOP/GADD153.
22289049 2012 Melatonin enhances thapsigargin-induced apoptosis through reactive oxygen species-mediated upregulation of CCAAT-enhancer-binding protein homologous protein in human renal cancer cells.
22261448 2012 The expanded histologic spectrum of myxoid liposarcoma with an emphasis on newly described patterns: implications for diagnosis on small biopsy specimens.
22246806 2012 Saturated fatty acid induction of endoplasmic reticulum stress and apoptosis in human liver cells via the PERK/ATF4/CHOP signaling pathway.
22210905 2012 CHOP is a multifunctional transcription factor in the ER stress response.
22157935 2012 The new molecular markers DDIT3, STT3A, ARG2 and FAM129A are not useful in diagnosing thyroid follicular tumors.
22146569 2012 Endoplasmic reticulum stress is activated in endometrial adenocarcinoma.
22096849 2011 [The effects of the cadmium chloride on the DNA damage and the expression level of gadd gene in HepG2 cell line].
22065586 2012 Oncogenic Ras and B-Raf proteins positively regulate death receptor 5 expression through co-activation of ERK and JNK signaling.
21966512 2011 Hepatitis E virus ORF2 protein activates the pro-apoptotic gene CHOP and anti-apoptotic heat shock proteins.
21873270 2011 Transgenic zebrafish model to study translational control mediated by upstream open reading frame of human chop gene.
21801305 2012 Salermide up-regulates death receptor 5 expression through the ATF4-ATF3-CHOP axis and leads to apoptosis in human cancer cells.
21741997 2011 C/EBP ? targets to neutrophil gelatinase-associated lipocalin (NGAL) as a repressor for metastasis of MDA-MB-231 cells.
21732477 2011 FUS-CHOP fusion protein expression coupled to p53 deficiency induces liposarcoma in mouse but not in human adipose-derived mesenchymal stem/stromal cells.
21700680 2011 BRCA1 loss induces GADD153-mediated doxorubicin resistance in prostate cancer.
21697995 2011 Induction of the unfolded protein response by cigarette smoke is primarily an activating transcription factor 4-C/EBP homologous protein mediated process.
21697087 2011 Modulation of CCAAT/enhancer binding protein homologous protein (CHOP)-dependent DR5 expression by nelfinavir sensitizes glioblastoma multiforme cells to tumor necrosis factor-related apoptosis-inducing ligand (TRAIL).
21479362 2011 Involvement of endoplasmic reticulum stress in adenosine-induced human hepatoma HepG2 cell apoptosis.
21471847 2011 Interleukin-8 overexpression in astrocytomas is induced by prostaglandin E2 and is associated with the transcription factors CCAAT/enhancer-binding protein-? and CCAAT/enhancer-binding homologous protein.
21402790 2011 A CHOP-regulated microRNA controls rhodopsin expression.
21365646 2012 Impact of intracellular alpha fetoprotein on retinoic acid receptors-mediated expression of GADD153 in human hepatoma cell lines.
21285359 2011 Phosphorylation of eIF2 facilitates ribosomal bypass of an inhibitory upstream ORF to enhance CHOP translation.
21189163 2010 Analysis of changes in pro (Gadd153) and anti apoptotic (Grp78) gene expression after ischemic-reperfusion injury of the small intestine.
21179554 2010 Inhibition of stearoyl-CoA desaturase 1 expression induces CHOP-dependent cell death in human cancer cells.
21044953 2010 ERK/ribosomal S6 kinase (RSK) signaling positively regulates death receptor 5 expression through co-activation of CHOP and Elk1.
20889551 2010 Repression of peroxisome proliferator-activated receptor gamma by mucosal ribotoxic insult-activated CCAAT/enhancer-binding protein homologous protein.
20876114 2010 Endoplasmic reticulum stress-induced transcription factor, CHOP, is crucial for dendritic cell IL-23 expression.
20829347 2010 Endoplasmic reticulum stress-activated C/EBP homologous protein enhances nuclear factor-kappaB signals via repression of peroxisome proliferator-activated receptor gamma.
20554776 2010 Coxsackievirus B3 infection activates the unfolded protein response and induces apoptosis through downregulation of p58IPK and activation of CHOP and SREBP1.
20492726 2010 Methylation status of DDIT3 gene in chronic myeloid leukemia.
20430872 2010 CHOP and AP-1 cooperatively mediate PUMA expression during lipoapoptosis.
20424162 2010 Regulation of CCAAT/enhancer-binding protein homologous protein (CHOP) expression by interleukin-1 beta in pancreatic beta cells.
20122151 2010 Autophagy induction and CHOP under-expression promotes survival of fibroblasts from rheumatoid arthritis patients under endoplasmic reticulum stress.
20116099 2010 Aberrant methylation of DNA-damage-inducible transcript 3 promoter is a common event in patients with myelodysplastic syndrome.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20032083 2010 Nitric oxide reduces SLC29A1 promoter activity and adenosine transport involving transcription factor complex hCHOP-C/EBPalpha in human umbilical vein endothelial cells from gestational diabetes.
20017906 2009 DDIT3/CHOP and the sarcoma fusion oncoprotein FUS-DDIT3/TLS-CHOP bind cyclin-dependent kinase 2.
19934253 2010 Differential regulation of CHOP translation by phosphorylated eIF4E under stress conditions.
19855386 2009 Adaptive suppression of the ATF4-CHOP branch of the unfolded protein response by toll-like receptor signalling.
19816510 2010 Essential role of the unfolded protein response regulator GRP78/BiP in protection from neuronal apoptosis.
19744850 2009 CHOP and the endoplasmic reticulum stress response in myelinating glia.
19733664 2009 Involvement of CHOP, an ER-stress apoptotic mediator, in both human sporadic ALS and ALS model mice.
19723703 2010 Antiapoptotic roles of ceramide-synthase-6-generated C16-ceramide via selective regulation of the ATF6/CHOP arm of ER-stress-response pathways.
19722195 2010 N-acetyl cysteine and penicillamine induce apoptosis via the ER stress response-signaling pathway.
19672300 2009 ER stress-inducible factor CHOP affects the expression of hepcidin by modulating C/EBPalpha activity.
19558691 2009 CHOP 5'UTR-c.279T>C and +nt30C>T variants are not associated with overweight condition or with tumors/cancer in Italians - a case-control study.
19470730 2009 Activation of the unfolded protein response is associated with favorable prognosis in acute myeloid leukemia.
19116245 2009 Transcriptional regulation of the human growth hormone receptor (hGHR) gene V2 promoter by transcriptional activators and repressor.
19107326 2009 Up regulation of the GRP-78 and GADD-153 and down regulation of Bcl-2 proteins in primary glomerular diseases: a possible involvement of the ER stress pathway in glomerulonephritis.
19061639 2008 Role of SERCA1 truncated isoform in the proapoptotic calcium transfer from ER to mitochondria during ER stress.
19037087 2009 Rottlerin induces apoptosis via death receptor 5 (DR5) upregulation through CHOP-dependent and PKC delta-independent mechanism in human malignant tumor cells.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18940792 2008 C/EBP homology protein (CHOP) interacts with activating transcription factor 4 (ATF4) and negatively regulates the stress-dependent induction of the asparagine synthetase gene.
18850010 2009 The myxoid liposarcoma FUS-DDIT3 fusion oncoprotein deregulates NF-kappaB target genes by interaction with NFKBIZ.
18772138 2008 Regulation of interleukin-8 gene at a distinct site of its promoter by CCAAT enhancer-binding protein homologous protein in prostaglandin E2-treated human T cells.
18680108 2008 CHOP T/C and C/T haplotypes contribute to early-onset type 2 diabetes in Italians.
18679584 2008 Brefeldin A activates CHOP promoter at the AARE, ERSE and AP-1 elements.
18593935 2008 CAAT/enhancer binding protein homologous protein-dependent death receptor 5 induction is a major component of SHetA2-induced apoptosis in lung cancer cells.
18541659 2008 Shiga toxin 2 causes apoptosis in human brain microvascular endothelial cells via C/EBP homologous protein.
18534616 2008 Intrinsically disordered human C/EBP homologous protein regulates biological activity of colon cancer cells during calcium stress.
18396163 2008 Role of the repressor JDP2 in the amino acid-regulated transcription of CHOP.
18394432 2008 Induction of apoptosis by cigarette smoke via ROS-dependent endoplasmic reticulum stress and CCAAT/enhancer-binding protein-homologous protein (CHOP).
18278507 2008 Endoplasmic reticulum stress induced by oxidative stress in retinal pigment epithelial cells.
17968315 2008 Celecoxib and a novel COX-2 inhibitor ON09310 upregulate death receptor 5 expression via GADD153/CHOP.
17872950 2007 Critical and functional regulation of CHOP (C/EBP homologous protein) through the N-terminal portion.
17709599 2008 CHOP transcription factor mediates IL-8 signaling in cystic fibrosis bronchial epithelial cells.
17686866 2007 West Nile virus infection activates the unfolded protein response, leading to CHOP induction and apoptosis.
17652152 2007 Selective progesterone receptor modulator asoprisnil induces endoplasmic reticulum stress in cultured human uterine leiomyoma cells.
17647282 2007 Relevance of translocation type in myxoid liposarcoma and identification of a novel EWSR1-DDIT3 fusion.
17620318 2007 Linkage studies for T2D in Chop and C/EBPbeta chromosomal regions in Italians.
17616685 2007 The unhydrolyzable fenretinide analogue 4-hydroxybenzylretinone induces the proapoptotic genes GADD153 (CHOP) and Bcl-2-binding component 3 (PUMA) and apoptosis that is caspase- dependent and independent of the retinoic acid receptor.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17513780 2007 A novel RBP-J kappa-dependent switch from C/EBP beta to C/EBP zeta at the C/EBP binding site on the C-reactive protein promoter.
17468515 2007 Fat-specific FUS-DDIT3-transgenic mice establish PPARgamma inactivation is required to liposarcoma development.
17276738 CHOP (C/EBP homologous protein) and ASNS (asparagine synthetase) induction in cybrid cells harboring MELAS and NARP mitochondrial DNA mutations.
17273769 2007 Fenretinide up-regulates DR5/TRAIL-R2 expression via the induction of the transcription factor CHOP and combined treatment with fenretinide and TRAIL induces synergistic apoptosis in colon cancer cell lines.
17171638 2007 Curcumin-induced GADD153 upregulation: modulation by glutathione.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16958678 2006 Unfolding new mechanisms of alcoholic liver disease in the endoplasmic reticulum.
16942595 2006 Induction of transcription factor CEBP homology protein mediates hypoglycaemia-induced necrotic cell death in human neuroblastoma cells.
16651630 2006 The myxoid/round cell liposarcoma fusion oncogene FUS-DDIT3 and the normal DDIT3 induce a liposarcoma phenotype in transfected human fibrosarcoma cells.
16541075 2006 The finished DNA sequence of human chromosome 12.
16463383 2006 Green tea polyphenol stimulates cancer preventive effects of celecoxib in human lung cancer cells by upregulation of GADD153 gene.
16434966 2006 The C/EBP homologous protein CHOP (GADD153) is an inhibitor of Wnt/TCF signals.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16098044 2005 Ultraviolet light (UVB and UVA) induces the damage-responsive transcription factor CHOP/gadd153 in murine and human epidermis: evidence for a mechanism specific to intact skin.
16005964 2005 Decreased expression of CCAAT/enhancer binding protein zeta (C/EBPzeta) in patients with different myeloid diseases.
15917187 2005 ROS mediates 4HPR-induced posttranscriptional expression of the Gadd153 gene.
15870698 2005 Oncogenic Ras-mediated downregulation of Gadd153/CHOP is required for Ras-induced cellular transformation.
15775988 2005 TRB3, a novel ER stress-inducible gene, is induced via ATF4-CHOP pathway and is involved in cell death.
15688424 2005 Myxoid liposarcoma FUS-DDIT3 fusion oncogene induces C/EBP beta-mediated interleukin 6 expression.
15659384 2005 Prostaglandin E2 induces interleukin-8 gene transcription by activating C/EBP homologous protein in human T lymphocytes.
15588942 2004 Protein partners of C/EBPepsilon.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15327748 2004 Hydrogen peroxide induces GADD153 in Jurkat cells through the protein kinase C-dependent pathway.
15322075 2004 CHOP is involved in endoplasmic reticulum stress-induced apoptosis by enhancing DR5 expression in human carcinoma cells.
15316935 2005 Increased GADD gene expression in human colon epithelial cells exposed to deoxycholate.
15308577 2004 Retinoic acid regulates C/EBP homologous protein expression (CHOP), which negatively regulates myeloid target genes.
15286712 2004 Comparable transforming capacities and differential gene expression patterns of variant FUS/CHOP fusion transcripts derived from soft tissue liposarcomas.
15277326 2004 C-reactive protein induces apoptosis in human coronary vascular smooth muscle cells.
15271854 2004 Curcumin-induced GADD153 gene up-regulation in human colon cancer cells.
15053923 2004 Increased GADD153 gene expression during iron chelation-induced apoptosis in Jurkat T-lymphocytes.
15001576 2004 TRAF7 potentiates MEKK3-induced AP1 and CHOP activation and induces apoptosis.
14685163 2004 Roles of CHOP/GADD153 in endoplasmic reticulum stress.
14669326 2003 Oil A induces apoptosis of pancreatic cancer cells via caspase activation, redistribution of cell cycle and GADD expression.
14667815 2004 Regulation of aldehyde reductase expression by STAF and CHOP.
14635187 2003 Induction of GADD gene expression by phenethylisothiocyanate in human colon adenocarcinoma cells.
14630918 2004 Induction of CHOP expression by amino acid limitation requires both ATF4 expression and ATF2 phosphorylation.
12939601 2003 Transcriptional regulation of the human transferrin gene by GADD153 in hepatoma cells.
12876286 2003 CHOP transcription factor phosphorylation by casein kinase 2 inhibits transcriptional activation.
12805554 2003 Comprehensive identification of human bZIP interactions with coiled-coil arrays.
12706815 2003 C/EBP homologous protein (CHOP) up-regulates IL-6 transcription by trapping negative regulating NF-IL6 isoform.
12618752 2003 C/EBP family transcription factors are degraded by the proteasome but stabilized by forming dimer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12297725 2002 Down-regulation of TFF expression in gastrointestinal cell lines by cytokines and nuclear factors.
12168790 2002 GADD153 is an independent prognostic factor in melanoma: immunohistochemical and molecular genetic analysis.
12138118 2002 GADD153-mediated anticancer effects of N-(4-hydroxyphenyl)retinamide on human hepatoma cells.
12097650 2002 Genomic sequences necessary for transcriptional activation by amino acid deprivation of mammalian cells.
12082616 2002 Expression and transactivating functions of the bZIP transcription factor GADD153 in mammary epithelial cells.
12069855 2002 Activator protein-1 and CCAAT/enhancer-binding protein mediated GADD153 expression is involved in deoxycholic acid-induced apoptosis.
12006103 2002 CCAAT/enhancer-binding proteins: structure, function and regulation.
11948400 2002 Activation of peroxisome proliferator-activated receptor-gamma stimulates the growth arrest and DNA-damage inducible 153 gene in non-small cell lung carcinoma cells.
11805088 2002 Nitric oxide-induced apoptosis in RAW 264.7 macrophages is mediated by endoplasmic reticulum stress pathway involving ATF6 and CHOP.
11691921 2001 Inhibition of CHOP translation by a peptide encoded by an open reading frame localized in the chop 5'UTR.
11478948 2001 The cAMP response element binding protein-2 (CREB-2) can interact with the C/EBP-homologous protein (CHOP).
10713066 2000 Novel interaction between the transcription factor CHOP (GADD153) and the ribosomal protein FTE/S3a modulates erythropoiesis.
10523647 1999 CHOP enhancement of gene transcription by interactions with Jun/Fos AP-1 complex proteins.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8662954 1996 Physical and functional association between GADD153 and CCAAT/enhancer-binding protein beta during cellular stress.
8650547 1996 Stress-induced phosphorylation and activation of the transcription factor CHOP (GADD153) by p38 MAP Kinase.
8637704 1996 Fusion of the EWS and CHOP genes in myxoid liposarcoma.
8622660 1996 Analysis of ATF3, a transcription factor induced by physiological stresses and modulated by gadd153/Chop10.
8510758 1993 Fusion of CHOP to a novel RNA-binding protein in human myxoid liposarcoma.
7503811 1993 Fusion of the dominant negative transcription regulator CHOP with a novel gene FUS by translocation t(12;16) in malignant liposarcoma.
2372777 1990 Localization of the chromosomal breakpoints of the t(12;16) in liposarcoma to subbands 12q13.3 and 16p11.2.
1990262 1991 Induction by ionizing radiation of the gadd45 gene in cultured human cells: lack of mediation by protein kinase C.
1547942 1992 CHOP, a novel developmentally regulated nuclear protein that dimerizes with transcription factors C/EBP and LAP and functions as a dominant-negative inhibitor of gene transcription.
1339368 1992 Isolation, characterization and chromosomal localization of the human GADD153 gene.
1283316 1992 Rearrangement of the transcription factor gene CHOP in myxoid liposarcomas with t(12;16)(q13;p11).