Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.97
PubTator Score 3.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.008 1.1e-02
adult high grade glioma 1.300 4.6e-04
atypical teratoid / rhabdoid tumor 1.900 2.6e-07
glioblastoma 1.700 4.3e-07
group 3 medulloblastoma 2.300 1.3e-04
invasive ductal carcinoma 1.500 6.8e-04
medulloblastoma, large-cell 2.300 1.2e-06
non-small cell lung cancer 1.407 1.7e-11
ovarian cancer 1.100 1.2e-04
primary Sjogren syndrome 1.100 1.2e-03
primitive neuroectodermal tumor 2.100 4.9e-05
psoriasis 1.500 3.8e-87

Gene RIF (5)

AA Sequence

MNRRRKFLLASVLALQNSSFIYPSCQKCFSRIILVSKRSNCPKCGSTGESGNANYRYKLSLKVAESNKLF      1 - 70
VITVFGSCLDTFFGLTATGLHRYIQDPNKIPETLDNDTTQNLLTKAVETCFVGQSFIFGVTNFENQPGQG     71 - 140
SDASNFLQQCSDHKRKAKALVACQIVLPDPGIAGFTVIDYFHQLLQTFNFRKLQCDSQAPNNHLLALDHS    141 - 210
NSDLSSIYTSDSTSDFFKSCSKDTFSKFWQPSLEFTCIVSQLTDNDDFSASEQSKAFGTLQQNRKSISIA    211 - 280
EATGSSSCHDPIQDSWSLVSYMDKKSTAEKLGKELGLQAKELSAVHSSHHEIGVNDSNLFSLEMREPLES    281 - 350
SNTKSFHSAVEIKNRSQHELPCFQHHGIDTPTSLQKRSACCPPSLLRLEETASSSQDGDPQIWDDLPFSE    351 - 420
SLNKFLAVLESEIAVTQADVSSRKHHVDNDIDKFHADHSRLSVTPQRTTGALHTPPIALRSSQVIVKANC    421 - 490
SKDDFLFNCKGNLSPSVEKESQPDNKVEAVSVNHNGRDMSEYFLPNPYLSALSSSSKDLETIVTLKKTIR    491 - 560
ISPHRESDHSSLNNKYLNGCGEISVSEMNEKLTTLCYRKYNDVSDLCKLENKQYCRWSKNQDDSFTICRK    561 - 630
LTYPLETLCNSPNRSTNTLKEMPWGHINNNVTQSYSIGYEGSYDASADLFDDIAKEMDIATEITKKSQDI    631 - 700
LLKWGTSLAESHPSESDFSLRSLSEDFIQPSQKLSLQSLSDSRHSRTCSPTPHFQSDSEYNFENSQDFVP    701 - 770
CSQSTPISGFHQTRIHGINRAFKKPVFYSDLDGNYEKIRIFPENDKQQASPSCPKNIKTPSQKIRSPIVS    771 - 840
GVSQPDVFNHYPFAECHETDSDEWVPPTTQKIFPSDMLGFQGIGLGKCLAAYHFPDQQELPRKKLKHIRQ    841 - 910
GTNKGLIKKKLKNMLAAVVTKKKTHKYNCKSSGWISKCPDIQVLAAPQLHPILGPDSCSEVKCCLPFSEK    911 - 980
GPPSVCETRSAWSPELFS                                                        981 - 998
//

Text Mined References (13)

PMID Year Title