Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.17
PubTator Score 1.44

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.855 9.2e-06
juvenile dermatomyositis 1.031 3.5e-07
acute quadriplegic myopathy 1.053 8.9e-04
tuberculosis -1.200 5.7e-07
interstitial cystitis -1.100 1.4e-04
adult high grade glioma -1.100 2.7e-04
spina bifida -1.075 4.9e-02
ovarian cancer -1.300 4.7e-04

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGD      1 - 70
VVILRQKENADPRPPVQFPNLPRIDFSSIAVPGTSSPRQRQPPGTQQSHSSPGEITSSPQGLDNPALLRD     71 - 140
MLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDI    141 - 210
RQQNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAG    211 - 280
IAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQT    281 - 350
TFLPEGELPECARLAYGAGREDVRPEEIADQELAEALQKSAEDAERQKP                         351 - 399
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.