Property Summary

NCBI Gene PubMed Count 17
PubMed Score 15.32
PubTator Score 11.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.200 3.2e-03
ependymoma -1.100 9.0e-06
glioblastoma -1.200 1.5e-03
group 3 medulloblastoma -1.100 2.0e-03
juvenile dermatomyositis 1.064 9.6e-10
medulloblastoma, large-cell -1.200 6.1e-04
osteosarcoma 2.112 5.3e-07
ovarian cancer -1.700 1.1e-08
Polycystic ovary syndrome -1.126 2.7e-03
primary Sjogren syndrome 1.200 7.2e-03
psoriasis 1.200 1.3e-09
subependymal giant cell astrocytoma -1.360 4.5e-02
ulcerative colitis 1.200 4.1e-04

Gene RIF (4)

AA Sequence

MNYPGRGSPRSPEHNGRGGGGGAWELGSDARPAFGGGVCCFEHLPGGDPDDGDVPLALLRGEPGLHLAPG      1 - 70
TDDHNHHLALDPCLSDENYDFSSAESGSSLRYYSEGESGGGGSSLSLHPPQQPPLVPTNSGGGGATGGSP     71 - 140
GERKRTRLGGPAARHRYEVVTELGPEEVRWFYKEDKKTWKPFIGYDSLRIELAFRTLLQTTGARPQGGDR    141 - 210
DGDHVCSPTGPASSSGEDDDEDRACGFCQSTTGHEPEMVELVNIEPVCVRGGLYEVDVTQGECYPVYWNQ    211 - 280
ADKIPVMRGQWFIDGTWQPLEEEESNLIEQEHLNCFRGQQMQENFDIEVSKSIDGKDAVHSFKLSRNHVD    281 - 350
WHSVDEVYLYSDATTSKIARTVTQKLGFSKASSSGTRLHRGYVEEATLEDKPSQTTHIVFVVHGIGQKMD    351 - 420
QGRIIKNTAMMREAARKIEERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDI    421 - 490
MYYTSPLYRDELVKGLQQELNRLYSLFCSRNPDFEEKGGKVSIVSHSLGCVITYDIMTGWNPVRLYEQLL    491 - 560
QKEEELPDERWMSYEERHLLDELYITKRRLKEIEERLHGLKASSMTQTPALKFKVENFFCMGSPLAVFLA    561 - 630
LRGIRPGNTGSQDHILPREICNRLLNIFHPTDPVAYRLEPLILKHYSNISPVQIHWYNTSNPLPYEHMKP    631 - 700
SFLNPAKEPTSVSENEGISTIPSPVTSPVLSRRHYGESITNIGKASILGAASIGKGLGGMLFSRFGRSST    701 - 770
TQSSETSKDSMEDEKKPVASPSATTVGTQTLPHSSSGFLDSAYFRLQESFFNLPQLLFPENVMQNKDNAL    771 - 840
VELDHRIDFELREGLVESRYWSAVTSHTAYWSSLDVALFLLTFMYKHEHDDDAKPNLDPI              841 - 900
//

Text Mined References (21)

PMID Year Title