Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.97
PubTator Score 11.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma 2.112 5.3e-07
posterior fossa group A ependymoma -1.300 1.3e-09
glioblastoma -1.400 2.1e-04
medulloblastoma, large-cell -1.200 6.1e-04
juvenile dermatomyositis 1.064 9.6e-10
adult high grade glioma -1.200 3.2e-03
group 3 medulloblastoma -1.100 2.0e-03
primary Sjogren syndrome 1.200 7.2e-03
subependymal giant cell astrocytoma -1.360 4.5e-02
psoriasis 1.200 1.3e-09
Polycystic Ovary Syndrome -1.126 2.7e-03
ulcerative colitis 1.200 4.1e-04
ovarian cancer -1.700 1.1e-08

Protein-protein Interaction (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ

Gene RIF (3)

PMID Text
24989667 Two novel heterozygous mutations in DDHD1 were found in the affected members of one family, with clinical features overlapping the SPG28 subtype.
24599962 a possible mechanism of PA regulation of the mitochondrial membrane and demonstrate an in vivo function of PA-PLA1 in the organization of mitochondria during spermiogenesis.
20359546 DDHD1-LPI-GPR55 axis to be involved in functions in the brain.

AA Sequence

MNYPGRGSPRSPEHNGRGGGGGAWELGSDARPAFGGGVCCFEHLPGGDPDDGDVPLALLRGEPGLHLAPG      1 - 70
TDDHNHHLALDPCLSDENYDFSSAESGSSLRYYSEGESGGGGSSLSLHPPQQPPLVPTNSGGGGATGGSP     71 - 140
GERKRTRLGGPAARHRYEVVTELGPEEVRWFYKEDKKTWKPFIGYDSLRIELAFRTLLQTTGARPQGGDR    141 - 210
DGDHVCSPTGPASSSGEDDDEDRACGFCQSTTGHEPEMVELVNIEPVCVRGGLYEVDVTQGECYPVYWNQ    211 - 280
ADKIPVMRGQWFIDGTWQPLEEEESNLIEQEHLNCFRGQQMQENFDIEVSKSIDGKDAVHSFKLSRNHVD    281 - 350
WHSVDEVYLYSDATTSKIARTVTQKLGFSKASSSGTRLHRGYVEEATLEDKPSQTTHIVFVVHGIGQKMD    351 - 420
QGRIIKNTAMMREAARKIEERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDI    421 - 490
MYYTSPLYRDELVKGLQQELNRLYSLFCSRNPDFEEKGGKVSIVSHSLGCVITYDIMTGWNPVRLYEQLL    491 - 560
QKEEELPDERWMSYEERHLLDELYITKRRLKEIEERLHGLKASSMTQTPALKFKVENFFCMGSPLAVFLA    561 - 630
LRGIRPGNTGSQDHILPREICNRLLNIFHPTDPVAYRLEPLILKHYSNISPVQIHWYNTSNPLPYEHMKP    631 - 700
SFLNPAKEPTSVSENEGISTIPSPVTSPVLSRRHYGESITNIGKASILGAASIGKGLGGMLFSRFGRSST    701 - 770
TQSSETSKDSMEDEKKPVASPSATTVGTQTLPHSSSGFLDSAYFRLQESFFNLPQLLFPENVMQNKDNAL    771 - 840
VELDHRIDFELREGLVESRYWSAVTSHTAYWSSLDVALFLLTFMYKHEHDDDAKPNLDPI              841 - 900
//

Text Mined References (20)

PMID Year Title
24989667 2014 Impairment of brain and muscle energy metabolism detected by magnetic resonance spectroscopy in hereditary spastic paraparesis type 28 patients with DDHD1 mutations.
24599962 2014 Phosphatidic acid (PA)-preferring phospholipase A1 regulates mitochondrial dynamics.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23176821 2012 Alteration of fatty-acid-metabolizing enzymes affects mitochondrial form and function in hereditary spastic paraplegia.
22922100 2012 Roles of SAM and DDHD domains in mammalian intracellular phospholipase A1 KIAA0725p.
20359546 2010 Generation of lysophosphatidylinositol by DDHD domain containing 1 (DDHD1): Possible involvement of phospholipase D/phosphatidic acid in the activation of DDHD1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15786464 2005 Mapping of a new form of pure autosomal recessive spastic paraplegia (SPG28).
15623529 2005 p125 is localized in endoplasmic reticulum exit sites and involved in their organization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9488669 1998 Cloning of a phosphatidic acid-preferring phospholipase A1 from bovine testis.
7937808 1994 Identification of a phosphatidic acid-preferring phospholipase A1 from bovine brain and testis.