Property Summary

NCBI Gene PubMed Count 64
PubMed Score 122.46
PubTator Score 86.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease -1.012 1.7e-02
atypical teratoid / rhabdoid tumor 1.400 3.2e-06
ependymoma 1.800 6.9e-14
gastric carcinoma 1.200 9.8e-03
group 3 medulloblastoma 2.700 2.6e-06
intraductal papillary-mucinous neoplasm ... -1.100 2.5e-03
invasive ductal carcinoma -1.100 1.7e-02
ovarian cancer 1.100 8.3e-04
pancreatic cancer 1.200 3.6e-03
primary pancreatic ductal adenocarcinoma 1.176 2.9e-03
primitive neuroectodermal tumor 1.600 2.0e-03
psoriasis -1.100 3.3e-07
subependymal giant cell astrocytoma 1.521 5.3e-03
ulcerative colitis -2.000 1.8e-08

Synonym

Accession O95865 A2BEZ7 DDAH-2
Symbols G6a
DDAH
NG30
DDAHII
HEL-S-277

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (45)

AA Sequence

MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLP      1 - 70
LGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDENATLDGTDVLFTGREFFVGL     71 - 140
SKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVAGSSDAAQKAVRAMAVLTDHPYASL    141 - 210
TLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLS    211 - 280
TRPHS                                                                     281 - 285
//

Text Mined References (66)

PMID Year Title