Property Summary

NCBI Gene PubMed Count 63
PubMed Score 130.74
PubTator Score 182.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
nephrosclerosis -1.386 2.8e-03
astrocytic glioma 1.400 2.9e-02
oligodendroglioma 1.100 5.5e-03
esophageal adenocarcinoma 1.700 3.0e-02
psoriasis -1.800 4.1e-08
group 3 medulloblastoma -1.800 3.2e-05
cystic fibrosis -1.736 6.4e-04
glioblastoma -1.900 2.2e-02
medulloblastoma, large-cell -2.200 1.3e-03
adrenocortical carcinoma -1.462 5.6e-03
non-small cell lung cancer -1.297 7.6e-10
intraductal papillary-mucinous neoplasm ... 1.100 1.5e-02
lung cancer -2.300 1.7e-05
interstitial cystitis -1.300 3.4e-03
Alzheimer's disease -1.400 1.9e-02
Pick disease -1.500 1.5e-06
progressive supranuclear palsy -1.200 1.2e-02
ovarian cancer 2.800 2.1e-05
chronic rhinosinusitis -1.032 1.4e-02

Synonym

Accession O94760 Q5HYC8 Q86XK5 DDAH-1
Symbols DDAH
DDAHI
DDAH-1
HEL-S-16

Gene

PANTHER Protein Class (1)

PDB

2JAI   2JAJ   3I2E   3I4A   3P8E   3P8P  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (49)

PMID Text
26662939 The most significant associations were detected for PECAM1*V/V + DDAH1*C (OR = 4.17 CI 1.56-11.15 Pperm = 0.005)
26455824 results suggest that miR-21 may regulate renal fibrosis by the Wnt pathway via directly targeting DDAH1
26226438 FoxO1 regulates asymmetric dimethylarginine via downregulation of dimethylaminohydrolase 1 in HUVECs and subjects with carotid atherosclerosis.
26082478 Inhibiting the expression of DDAH1, but not DDAH2, resulted in a significant increase in the sensitivity of the EVT cell line SGHPL-4 to tumour necrosis factor related apoptosis inducing ligand (TRAIL) induced apoptosis
25424718 Genebased analyses revealed associations of the DDAH1 gene with longitudinal Blood Pressure phenotypes, associations with essential hypertension, Blood Pressure salt sensitivity, preeclampsia, or preclinical stages of atherosclerosis.
25194333 increased ADMA levels in rheumatoid arthritis do not appear to relate to DDAH genetic polymorphisms
24260221 DDAH1 deficiency attenuates endothelial cell cycle progression and angiogenesis.
23892448 DDAH1 genotypes were closely related to asymmetric dimethylarginine levels, but not to measures of endothelium-dependent vasodilation in an elderly population.
23864585 Only the DDAH1-V1 transcript is responsible for ADMA metabolism, and transcript specific primers are recommended to determine DDAH1 mRNA expression.
23766377 the advanced glycation end products-receptor for advanced glycation end products-mediated reactive oxygen species generation could be involved in endothelial dysfunction in diabetic end-stage renal disease patients
23022711 Elevated asymmetric dimethylaginine is not a part of the proatherogenic risk profile in the young adult offspring of patients with premature Coronary artery disease.
22982060 Data suggest that estradiol alone has no effect on DDAH/asymmetric dimethylarginine/nitric oxide pathway in arterial endothelium, but rather counters oxidized LDL; estradiol restores DDAH activity and prevents loss of eNOS (nitric oxide synthase 3).
22700861 DDAH1 gene DNA methylation is impoetant in the pathogenesis of idiopathic pulmonary fibrosis.
22521321 Genetic polymorphisms in DDAH genes influence serum ADMA levels in individuals with T1 diabetes mellitus.
22492959 High DDAH1 is associated with pediatric diffuse intrinsic pontine glioma.
21975354 Non-diabetic hypertensive subjects with a hypertensive response to exercise compared to those with normal response were characterized by augmented asymmetric dimethylarginine and osteoprotegerin levels.
21722652 In acute congestive heart failure acute renal impairment function and the modulation of metabolism and extracellular transport by the DDAH-1/CAT-1 system determine high ADMA and SDMA levels after therapy for acute congestive heart failure.
21677199 Data show that DDAH inhibition reduces fibroblast-induced collagen deposition in an ADMA-independent manner and reduces abnormal epithelial proliferation in an ADMA-dependent manner.
21493890 Indicate that DDAH1 is required for metabolizing asymmetrical dimethylarginine and N(omega)-monomethyl-L-arginine.
21420186 A significant decrease in asymmetric dimethylarginine levels was found in ex-extremely low birth weight young adults compared to term birth weight young adults.
21303562 Results provide evidence that SNP rs1241321 in DDAH1 is associated with type 2 diabetes and its long-term outcome.
21264497 HDL significantly increased the attenuated endothelial cell NO production induced by ox-LDL, which was attributed to its effect on DDAH/ADMA pathway
21212404 DDAH1 exerts a unique role in activating Akt that affects endothelial function independently of degrading endogenous nitirc oxide synthase inhibitors.
21174581 did not find evidence for association with pre-eclampsia
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20209122 DDAH1 and DDAH2 polymorphisms are strongly and additively associated with serum ADMA concentrations in individuals with type 2 diabetes
20209122 Observational study of gene-disease association. (HuGE Navigator)
20167924 Results suggest that the DDAH1 loss-of-function polymorphism is associated with both increased risk of thrombosis stroke and coronary artery disease in the Chinese Han population.
20167924 Observational study of gene-disease association. (HuGE Navigator)
20019334 Recombinant human DDAH1 overexpression protects transgenic mice from adverse structural and functional changes in cerebral arterioles in hyperhomocysteinemia but not from accelerated carotid artery thrombosis induced by the HM/LF diet.
20010544 Circulating methylarginine levels and the decline in renal function in patients with chronic kidney disease are modulated by DDAH1 polymorphisms.
20010544 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19682581 Recent studies in this review suggest that DDAH may regulate endothelial nitric oxide activity and endothelial function through both asymmetric dimethylarginine-dependent and -independent mechanisms.
19666120 Expression of hDDAH1 messenger RNA is found in all organs of DDAH1 transgenic mice investigated, whereas human DDAH1 is absent in wild-type littermates.
18292189 maintenance of normoglycemia and not glycemia-independent actions of insulin maintained dimethylarginine tissue levels by preserving physiological DDAH activity.
18251679 Observational study of gene-disease association. (HuGE Navigator)
17895252 human dimethylarginine dimethylaminohydrolase-1 is inhibited by S-nitroso-L-homocysteine and hydrogen peroxide
17881609 Demonstrate a critical role for DDAH-1 and endogenous methylarginines in the pathogenesis of endothelial dysfunction.
17273169 DDAH-1 activity leads to accumulation of asymmetric dimethylarginine and reduction in nitric oxide signaling.
17075694 it is concluded that L-arginine regulates asymmetric dimethylarginine (ADMA) metabolism dose-dependently by competing for DDAH thus maintaining the metabolic balance of L-arginine and ADMA, and endothelial NO homeostasis
16920729 DDAH-1 and DDAH-2 messenger RNA and protein were demonstrated in first trimester placental tissue, primary extravillous trophoblasts and extravillous trophoblast-derived cell lines.
15781754 By increasing the synthesis of the proangiogenic factor nitric oxide, DDAH promotes postnatal angiogenesis and arteriogenesis.
15501905 Observational study of gene-disease association. (HuGE Navigator)
15501905 The first evidence of the importance of DDAH1 polymorphisms in pre-eclampsia susceptibility was provided.
11811522 hydrolyzes methylated inhibitors of nitric oxide synthase is present in circulating human red blood cells

AA Sequence

MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADES      1 - 70
LPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFV     71 - 140
GLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYD    141 - 210
KLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLIN    211 - 280
KKVDS                                                                     281 - 285
//

Text Mined References (69)

PMID Year Title
26662939 2016 Genotype/allelic combinations as potential predictors of myocardial infarction.
26455824 2016 MicroRNA21 promotes interstitial fibrosis via targeting DDAH1: a potential role in renal fibrosis.
26226438 2015 FoxO1 regulates asymmetric dimethylarginine via downregulation of dimethylaminohydrolase 1 in human endothelial cells and subjects with atherosclerosis.
26082478 2015 Inhibition of DDAH1, but not DDAH2, results in apoptosis of a human trophoblast cell line in response to TRAIL.
25424718 2015 Associations of Endothelial System Genes With Blood Pressure Changes and Hypertension Incidence: The GenSalt Study.
25245031 2014 Genome-wide association study of L-arginine and dimethylarginines reveals novel metabolic pathway for symmetric dimethylarginine.
25194333 2014 Relationship between dimethylarginine dimethylaminohydrolase gene variants and asymmetric dimethylarginine in patients with rheumatoid arthritis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260221 2013 DDAH1 deficiency attenuates endothelial cell cycle progression and angiogenesis.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23892448 2013 Genetic variation in the dimethylarginine dimethylaminohydrolase 1 gene (DDAH1) is related to asymmetric dimethylarginine (ADMA) levels, but not to endothelium-dependent vasodilation.
23864585 2013 Correlations of DDAH1 transcript variants with human endothelial asymmetric dimethylarginine metabolizing activity.
23766377 2013 Involvement of advanced glycation end product-induced asymmetric dimethylarginine generation in endothelial dysfunction.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23022711 2012 Parental history of premature coronary artery disease does not affect plasma levels of asymmetric dimethylarginine in young healthy adults.
22982060 2013 Estradiol, acting through estrogen receptor alpha, restores dimethylarginine dimethylaminohydrolase activity and nitric oxide production in oxLDL-treated human arterial endothelial cells.
22700861 2012 Altered DNA methylation profile in idiopathic pulmonary fibrosis.
22521321 Relationship between DDAH gene variants and serum ADMA level in individuals with type 1 diabetes.
22492959 2012 Insights into pediatric diffuse intrinsic pontine glioma through proteomic analysis of cerebrospinal fluid.
21975354 2011 Exercise blood pressure response is related to asymmetric dimethylarginine and osteoprotegerin in hypertension.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21722652 2011 The biological effect of pharmacological treatment on dimethylaminohydrolases (DDAH-1) and cationic amino acid transporter-1 (CAT-1) expression in patients with acute congestive heart failure.
21677199 2011 The role of dimethylarginine dimethylaminohydrolase in idiopathic pulmonary fibrosis.
21493890 2011 Dimethylarginine dimethylaminohydrolase-1 is the critical enzyme for degrading the cardiovascular risk factor asymmetrical dimethylarginine.
21420186 2012 Could ADMA levels in young adults born preterm predict an early endothelial dysfunction?
21303562 2011 The association of dimethylarginine dimethylaminohydrolase 1 gene polymorphism with type 2 diabetes: a cohort study.
21269460 2011 Initial characterization of the human central proteome.
21264497 2011 Protective effect of HDL on endothelial NO production: the role of DDAH/ADMA pathway.
21212404 2011 Dimethylarginine dimethylaminohydrolase 1 modulates endothelial cell growth through nitric oxide and Akt.
21174581 2012 Genetic variants, endothelial function, and risk of preeclampsia among American Indians.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20209122 2010 Sequence variation in DDAH1 and DDAH2 genes is strongly and additively associated with serum ADMA concentrations in individuals with type 2 diabetes.
20167924 2010 A novel loss-of-function DDAH1 promoter polymorphism is associated with increased susceptibility to thrombosis stroke and coronary heart disease.
20019334 2010 Overexpression of dimethylarginine dimethylaminohydrolase protects against cerebral vascular effects of hyperhomocysteinemia.
20010544 2010 Circulating methylarginine levels and the decline in renal function in patients with chronic kidney disease are modulated by DDAH1 polymorphisms.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19682581 2009 Role of the PRMT-DDAH-ADMA axis in the regulation of endothelial nitric oxide production.
19666120 2009 Extensive characterization of the human DDAH1 transgenic mice.
19663506 2009 Developing dual and specific inhibitors of dimethylarginine dimethylaminohydrolase-1 and nitric oxide synthase: toward a targeted polypharmacology to control nitric oxide.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18292189 2008 Glycemic control modulates arginine and asymmetrical-dimethylarginine levels during critical illness by preserving dimethylarginine-dimethylaminohydrolase activity.
18251679 2008 No association of the genetic polymorphisms of endothelial nitric oxide synthase, dimethylarginine dimethylaminohydrolase, and vascular endothelial growth factor with preeclampsia in Korean populations.
18171027 2008 Mechanism of 4-HNE mediated inhibition of hDDAH-1: implications in no regulation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17895252 2007 Inhibition of human dimethylarginine dimethylaminohydrolase-1 by S-nitroso-L-homocysteine and hydrogen peroxide. Analysis, quantification, and implications for hyperhomocysteinemia.
17881609 2007 Role of DDAH-1 in lipid peroxidation product-mediated inhibition of endothelial NO generation.
17273169 2007 Disruption of methylarginine metabolism impairs vascular homeostasis.
17075694 2006 L-arginine regulates asymmetric dimethylarginine metabolism by inhibiting dimethylarginine dimethylaminohydrolase activity in hepatic (HepG2) cells.
16920729 2006 Dimethylarginine dimethylaminohydrolase (DDAH) regulates trophoblast invasion and motility through effects on nitric oxide.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15781754 2005 Overexpression of dimethylarginine dimethylaminohydrolase reduces tissue asymmetric dimethylarginine levels and enhances angiogenesis.
15501905 2005 Haplotypic association of DDAH1 with susceptibility to pre-eclampsia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14638548 2003 Dimethylarginine dimethylaminohydrolase regulates nitric oxide synthesis: genetic and physiological evidence.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12441345 2003 Zn(II)-free dimethylargininase-1 (DDAH-1) is inhibited upon specific Cys-S-nitrosylation.
11546769 2001 Structural and functional characterization of the Zn(II) site in dimethylargininase-1 (DDAH-1) from bovine brain. Zn(II) release activates DDAH-1.
10950934 2000 Chromosomal localization, gene structure, and expression pattern of DDAH1: comparison with DDAH2 and implications for evolutionary origins.
10691782 2000 Intracellular localization of dimethylarginine dimethylaminohydrolase overexpressed in an endothelial cell line.
10493931 1999 Identification of two human dimethylarginine dimethylaminohydrolases with distinct tissue distributions and homology with microbial arginine deiminases.
9874257 1998 Purification, cDNA cloning and expression of human NG,NG-dimethylarginine dimethylaminohydrolase.
8982498 1996 Regulation of nitric oxide synthesis by dimethylarginine dimethylaminohydrolase.
7608105 1995 Detection of NG,NG-dimethylarginine dimethylaminohydrolase in human tissues using a monoclonal antibody.