Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.11
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2798 2.3e-21
ulcerative colitis 2087 3.4e-07
diabetes mellitus 1663 1.7e-03
ovarian cancer 8491 1.9e-03
osteosarcoma 7933 2.7e-02
Disease Target Count Z-score Confidence
Laryngeal squamous cell carcinoma 6 3.111 1.6
Disease Target Count
tuberculosis 1563

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.153 2.7e-02
non-small cell lung cancer 1.255 2.3e-21
diabetes mellitus -1.100 1.7e-03
ulcerative colitis 1.200 3.4e-07
ovarian cancer 1.900 1.9e-03

Synonym

Accession Q9BTE7 Q3ZTT2
Symbols SCCRO5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
24192928 SCCRO5 has oncogenic potential that requires its function as a component of the neddylation E3. Neddylation activity and nuclear localization of SCCRO5 are important for its in vivo function.
23098533 Overexpression of DCUN1D5 is associated with laryngeal squamous cell carcinoma.

AA Sequence

MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGM      1 - 70
EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKN     71 - 140
IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD    141 - 210
LSNYDEDGAWPVLLDEFVEWQKVRQTS                                               211 - 237
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
24192928 2014 Oncogenic function of SCCRO5/DCUN1D5 requires its Neddylation E3 activity and nuclear localization.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23098533 2012 In vitro biological characterization of DCUN1D5 in DNA damage response.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16533400 2006 NovelFam3000--uncharacterized human protein domains conserved across model organisms.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15988528 2005 The conserved protein DCN-1/Dcn1p is required for cullin neddylation in C. elegans and S. cerevisiae.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.