Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.58
PubTator Score 4.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.2e-34
tuberculosis 2010 7.5e-06
osteosarcoma 7950 2.1e-04
ductal carcinoma in situ 1745 6.7e-04
invasive ductal carcinoma 2951 1.5e-03

Expression

  Differential Expression (5)

Disease log2 FC p
ductal carcinoma in situ -1.100 6.7e-04
invasive ductal carcinoma -1.400 1.5e-03
osteosarcoma -1.291 2.1e-04
psoriasis 1.200 1.2e-34
tuberculosis -1.700 7.5e-06

Gene RIF (2)

AA Sequence

MGQCVTKCKNPSSTLGSKNGDREPSNKSHSRRGAGHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPT      1 - 70
SSGDAGRESKSNAEESSLQRLEELFRRYKDEREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMC     71 - 140
KFTRKEFFDGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWK    141 - 210
LVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMER    211 - 280
RKREGEGRGALSSGPEGLCPEEQT                                                  281 - 304
//

Text Mined References (11)

PMID Year Title