Property Summary

NCBI Gene PubMed Count 24
PubMed Score 23.37
PubTator Score 24.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.100 2.2e-02
malignant mesothelioma 1.100 4.6e-06
osteosarcoma -2.794 1.4e-08
medulloblastoma, large-cell -1.300 1.5e-05
acute quadriplegic myopathy 1.183 3.3e-05
tuberculosis and treatment for 6 months 1.800 1.6e-04
non-small cell lung cancer 1.638 1.3e-13
intraductal papillary-mucinous neoplasm ... 1.200 3.4e-02
sarcoidosis 1.200 4.1e-02
Breast cancer -2.900 4.8e-02
ovarian cancer 1.300 2.1e-03
pituitary cancer -1.300 1.9e-03

Synonym

Accession Q96GG9 B2RB37 Q7L3G9 Q8TEX7 Q9H6M1 Q9HCT3
Symbols RP42
SCRO
Tes3
DCNL1
SCCRO
DCUN1L1

Gene

PDB

3TDU   3TDZ   4P5O  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

PMID Text
25411243 The ubiquitin-associated (UBA) domain of SCCRO/DCUN1D1 protein serves as a feedback regulator of biochemical and oncogenic activity.
25349211 SCCRO3 functions as a tumor suppressor by antagonizing the neddylation activity of SCCRO
23401859 substrate engagement prompts DCNL1 recruitment that facilitates the initiation of CUL2 neddylation and define DCNL1 as a "substrate sensor switch" for ECV activation.
23201271 Distinct preferences of UBC12 and UBE2F peptides for inhibiting different DCNLs, including the oncogenic DCNL1.
21813641 a mono-ubiquitination-mediated mechanism that governs nuclear-cytoplasmic trafficking of hDCNL1, thereby regulating hDCNL1-dependent activation of the cullin-RING E3 ubiquitin ligases in selected cellular compartments.
19473369 The GG genotype of the DCUN1D1 rs4859147 Single Nucleotide Polymorphism represents a risk factor for the development of frontotemporal lobar degeneration , increasing the risk of about fourfold.
19473369 Observational study of gene-disease association. (HuGE Navigator)
18980971 SCCRO-induced invasion involves activation of MMP2 transcription in an AP2- and p53-dependent manner.
18826954 SCCRO recruits Ubc12 approximately NEDD8 to the CAND1-Cul1-ROC1 complex but that this is not sufficient to dissociate or overcome the inhibitory effects of CAND1 on cullin neddylation
17018598 SCCRO regulates Gli1--a key regulator of the hedgehog (HH) pathway.
15657565 Loss of SCRO expression in primary adrenocortical carcinoma is associated with worse outcome and may be a marker of progressive dedifferentiation in these tumors.

AA Sequence

MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN      1 - 70
RYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQ     71 - 140
IPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPK    141 - 210
DTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV                         211 - 259
//

Text Mined References (27)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
25411243 2015 The ubiquitin-associated (UBA) domain of SCCRO/DCUN1D1 protein serves as a feedback regulator of biochemical and oncogenic activity.
25349211 2014 SCCRO3 (DCUN1D3) antagonizes the neddylation and oncogenic activity of SCCRO (DCUN1D1).
23401859 2013 DCNL1 functions as a substrate sensor and activator of cullin 2-RING ligase.
23201271 2013 Structural conservation of distinctive N-terminal acetylation-dependent interactions across a family of mammalian NEDD8 ligation enzymes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21940857 2011 N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
21813641 2011 Mono-ubiquitination drives nuclear export of the human DCN1-like protein hDCNL1.
21269460 2011 Initial characterization of the human central proteome.
19473369 2009 DCUN1D1 is a risk factor for frontotemporal lobar degeneration.
18980971 2008 SCCRO (DCUN1D1) induces extracellular matrix invasion by activating matrix metalloproteinase 2.
18826954 2008 SCCRO (DCUN1D1) is an essential component of the E3 complex for neddylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17018598 2006 Squamous cell carcinoma related oncogene/DCUN1D1 is highly conserved and activated by amplification in squamous cell carcinomas.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15988528 2005 The conserved protein DCN-1/Dcn1p is required for cullin neddylation in C. elegans and S. cerevisiae.
15657565 2004 Squamous cell carcinoma-related oncogene is highly expressed in developing, normal, and adenomatous adrenal tissue but not in aggressive adrenocortical carcinomas.
15623817 2005 Two-step differential expression analysis reveals a new set of genes involved in thyroid oncocytic tumors.
15511464 2004 SCCRO expression correlates with invasive progression in bronchioloalveolar carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15123463 2004 Squamous cell carcinoma related oncogene regulates angiogenesis through vascular endothelial growth factor-A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12796399 2003 The role of novel oncogenes squamous cell carcinoma-related oncogene and phosphatidylinositol 3-kinase p110alpha in squamous cell carcinoma of the oral tongue.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10777668 2000 Cloning and expression analysis of a novel gene, RP42, mapping to an autism susceptibility locus on 6q16.