Property Summary

NCBI Gene PubMed Count 24
PubMed Score 26.05
PubTator Score 24.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.183 3.3e-05
Breast cancer -2.900 4.8e-02
intraductal papillary-mucinous neoplasm ... 1.200 3.4e-02
malignant mesothelioma 1.100 4.6e-06
medulloblastoma, large-cell -1.300 1.5e-05
non-small cell lung cancer 1.638 1.3e-13
osteosarcoma 1.902 5.8e-04
ovarian cancer 1.300 2.1e-03
pituitary cancer -1.300 1.9e-03
Rheumatoid arthritis 1.100 2.2e-02
sarcoidosis 1.200 4.1e-02
tuberculosis and treatment for 6 months 1.800 1.6e-04

Gene RIF (11)

AA Sequence

MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN      1 - 70
RYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQ     71 - 140
IPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPK    141 - 210
DTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV                         211 - 259
//

Text Mined References (27)

PMID Year Title