Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.43
PubTator Score 8.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4473 3.6e-04
psoriasis 6685 5.8e-04
invasive ductal carcinoma 2950 2.5e-03

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.200 5.8e-04
lung cancer 1.700 3.6e-04
invasive ductal carcinoma 1.300 2.5e-03

Synonym

Accession Q9H773
Symbols CDA03
RS21C6
XTP3TPA

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
24467396 DCTPP1 has a central role in the balance of dCTP and the metabolism of deoxycytidine analogues.
21671327 Human dCTP pyrophosphatase 1 binds and is inhibited by the small molecule triptolide in vitro.

AA Sequence

MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL      1 - 70
FQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRK     71 - 140
YTELPHGAISEDQAVGPADIPCDSTGQTST                                            141 - 170
//

Text Mined References (19)

PMID Year Title
26075750 2015 Human dCTP pyrophosphatase 1 promotes breast cancer cell growth and stemness through the modulation on 5-methyl-dCTP metabolism and global hypomethylation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24467396 2014 The NTP pyrophosphatase DCTPP1 contributes to the homoeostasis and cleansing of the dNTP pool in human cells.
24085278 2013 dCTP pyrophosphohydrase exhibits nucleic accumulation in multiple carcinomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21671327 2011 Triptolide directly inhibits dCTP pyrophosphatase.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15740738 2005 Dimeric dUTPases, HisE, and MazG belong to a new superfamily of all-alpha NTP pyrophosphohydrolases with potential "house-cleaning" functions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.