Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.65
PubTator Score 1.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -1.100 2.7e-02
psoriasis 1.300 2.9e-07
cutaneous lupus erythematosus 1.100 2.0e-03
osteosarcoma -1.454 8.7e-07
glioblastoma 1.600 7.9e-06
atypical teratoid / rhabdoid tumor 1.500 3.2e-08
group 4 medulloblastoma 1.600 4.9e-05
medulloblastoma, large-cell 1.700 4.5e-05
non-small cell lung cancer 1.071 4.4e-13
lung cancer 1.300 3.2e-04
pediatric high grade glioma 1.200 7.4e-05
Breast cancer 1.100 2.9e-09

Gene RIF (1)

PMID Text
20508983 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIR      1 - 70
PPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVV     71 - 140
PPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV                                141 - 182
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23455152 2013 Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15043994 2004 Dynactins p25 and p27 are predicted to adopt the LbetaH fold.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10525537 1999 Analysis of dynactin subcomplexes reveals a novel actin-related protein associated with the arp1 minifilament pointed end.