Property Summary

NCBI Gene PubMed Count 49
PubMed Score 67.31
PubTator Score 42.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 1.5e-15
psoriasis 6685 2.8e-06
diabetes mellitus 1663 1.0e-03

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -3.700 2.8e-06
osteosarcoma -5.058 1.5e-15
diabetes mellitus -1.200 1.0e-03

 MGI Phenotype (1)

Gene RIF (10)

PMID Text
25375884 Over-expression of p50/dynamitin results in upregulated amounts of pelletable HIV-1 CA cores in infected cells
25088759 dynamitin is involved in the regulation of Nav1.5 cell-surface density
20463029 the determinants of p50/DM required for self-oligomerization of the protein and for interactions with other subunits of the dynactin complex
19286658 Over-expression of p50/dynamitin results in upregulated amounts of pelletable HIV-1 CA cores in infected cells
18782227 The interaction between ZW10 and dynamitin showed that the N-terminal region of ZW10 is the major binding site for dynamitin and, like full-length ZW10, could move along microtubules to the centrosomal area in a dynein-dynactin-dependent manner.
18182012 Data show how dynamitin's different structural domains contribute to its ability to self-associate, interact with dynactin and assemble into a complex with its close binding partner, p24.
16369996 study does not support a major role for DCTN2 overexpression in carcinogenesis
15813749 DCTN2 is required in the earliest stages of peroxisome biogenesis.
15580264 the Sec23p component of the COPII complex directly interacts with the dynactin complex through the carboxy-terminal cargo-binding domain of p150(Glued).
14983524 Altered levels of Cep135 and p50 by RNAi and protein overexpression caused the release of endogenous partner molecules from centrosomes.

AA Sequence

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFS      1 - 70
DRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKTTVKESATEEKLTPVLLAK     71 - 140
QLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQLEATKNSKGGSGGKTTGTPPDSSLVTYELH    141 - 210
SRPEQDKFSQAAKVAELEKRLTELETAVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVE    211 - 280
ARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLL    281 - 350
THLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK                       351 - 401
//

Text Mined References (58)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25416956 2014 A proteome-scale map of the human interactome network.
25088759 2014 Dynamitin affects cell-surface expression of voltage-gated sodium channel Nav1.5.
24816561 2014 Ccdc13 is a novel human centriolar satellite protein required for ciliogenesis and genome stability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23704327 2013 The giant spectrin ?V couples the molecular motors to phototransduction and Usher syndrome type I proteins along their trafficking route.
23414759 2013 The herpesvirus VP1/2 protein is an effector of dynein-mediated capsid transport and neuroinvasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20978158 2010 A novel human dynactin-associated protein, dynAP, promotes activation of Akt, and ergosterol-related compounds induce dynAP-dependent apoptosis of human cancer cells.
20682791 2010 A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components.
20463029 2010 Molecular and functional basis for the scaffolding role of the p50/dynamitin subunit of the microtubule-associated dynactin complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18782227 2008 N-terminal region of ZW10 serves not only as a determinant for localization but also as a link with dynein function.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18182012 2008 Dynamitin mutagenesis reveals protein-protein interactions important for dynactin structure.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16541075 2006 The finished DNA sequence of human chromosome 12.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16369996 2006 Phenotypic changes associated with DYNACTIN-2 (DCTN2) over expression characterise SJSA-1 osteosarcoma cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16043481 2005 RPGR-ORF15, which is mutated in retinitis pigmentosa, associates with SMC1, SMC3, and microtubule transport proteins.
15813749 2005 Requirement for microtubules and dynein motors in the earliest stages of peroxisome biogenesis.
15580264 2005 Coupling of ER exit to microtubules through direct interaction of COPII with dynactin.
15570572 2005 Automated immobilized metal affinity chromatography/nano-liquid chromatography/electrospray ionization mass spectrometry platform for profiling protein phosphorylation sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14983524 2004 Interaction of Cep135 with a p50 dynactin subunit in mammalian centrosomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401177 2002 The Rab6 GTPase regulates recruitment of the dynactin complex to Golgi membranes.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11483508 2001 Mammalian Golgi-associated Bicaudal-D2 functions in the dynein-dynactin pathway by interacting with these complexes.
11153697 2000 Colocalization of dynactin subunits P150Glued and P50 with melanosomes in normal human melanocytes.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
10827182 2000 Protein kinase C-regulated dynamitin-macrophage-enriched myristoylated alanine-rice C kinase substrate interaction is involved in macrophage cell spreading.
10811826 2000 Formation of spindle poles by dynein/dynactin-dependent transport of NuMA.
10671518 2000 A dynactin subunit with a highly conserved cysteine-rich motif interacts directly with Arp1.
10525537 1999 Analysis of dynactin subcomplexes reveals a novel actin-related protein associated with the arp1 minifilament pointed end.
10226031 1999 The APC-associated protein EB1 associates with components of the dynactin complex and cytoplasmic dynein intermediate chain.
9700164 1998 ZW10 helps recruit dynactin and dynein to the kinetochore.
8647893 1996 Molecular characterization of the 50-kD subunit of dynactin reveals function for the complex in chromosome alignment and spindle organization during mitosis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.