Property Summary

NCBI Gene PubMed Count 16
PubMed Score 65.13
PubTator Score 13.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.114 1.4e-02
Multiple myeloma 1.926 9.4e-05
psoriasis 3.100 4.5e-05
osteosarcoma 1.861 6.2e-05
glioblastoma 1.100 5.3e-03
lung cancer 1.500 1.4e-04
posterior fossa group B ependymoma 1.200 5.6e-06
sonic hedgehog group medulloblastoma 1.300 1.2e-03
ovarian cancer -2.500 7.8e-09

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (3)

PMID Text
20665488 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20028759 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17602053 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRT      1 - 70
AENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATA     71 - 140
ARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ                                    141 - 178
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23740775 2013 Association of granulomatosis with polyangiitis (Wegener's) with HLA-DPB1*04 and SEMA6A gene variants: evidence from genome-wide analysis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20665488 2010 Gemcitabine metabolic and transporter gene polymorphisms are associated with drug toxicity and efficacy in patients with locally advanced pancreatic cancer.
20028759 2010 Single nucleotide polymorphisms of gemcitabine metabolic genes and pancreatic cancer survival and drug toxicity.
17602053 2007 An association between RRM1 haplotype and gemcitabine-induced neutropenia in breast cancer patients.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8448179 1993 Properties of an affinity-column-purified human deoxycytidylate deaminase.
7685356 1993 Primary structure of human deoxycytidylate deaminase and overexpression of its functional protein in Escherichia coli.
7642519 1995 Chromosomal location and structural organization of the human deoxycytidylate deaminase gene.
3627112 1987 Deoxycytidylate deaminase activity in non-stimulated and phytohemagglutinin-stimulated human lymphocytes, and in leukemic cells.