Property Summary

NCBI Gene PubMed Count 51
PubMed Score 155.53
PubTator Score 160.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus -4.800 3.6e-04
psoriasis 1.500 3.5e-04
posterior fossa group A ependymoma 1.700 1.1e-04
group 3 medulloblastoma 2.700 3.6e-03
non primary Sjogren syndrome sicca -1.100 1.7e-02
Breast cancer -2.000 1.5e-32

 IMPC Phenotype (1)

 CSPA Cell Line (2)

Protein-protein Interaction (7)

Gene RIF (19)

PMID Text
25346513 The effect of DCT on UVR DNA damage responses and survival pathways in melanocytes was examined by knockdown experiments using melanoma cells, neonatal melanoblasts in monoculture and in co-culture with keratinocytes.
24709887 Report dopachrome tautomerase expression in mealanocytic tumors.
22988252 Data suggest that macrophage migration inhibitory factor (MIF) and d-dopachrome tautomerase (d-DT) act cooperatively to inhibit steady-state phosphorylation and activation of AMPK in LKB1 wild type and LKB1 mutant non-small cell lung carcinomas cells.
22898827 The results suggested that the miRNAs may be involved in MITF regulation of TYR, TYRP1 and TYRP2, which provides a new clue for understanding the role of miRNAs in melanocyte dysfunctional disease.
20520707 human TRP2 counteracts apoptotic cell death induction, possibly by means of its L-dopachrome tautomerase activity, and negatively affects the p53 pathway
20356546 Trp2 SNP2 allele is a risk factor for the development and severity of degenerative disc disease in a Chinese Han population.
20356546 Observational study of gene-disease association. (HuGE Navigator)
20221248 Observational study of gene-disease association. (HuGE Navigator)
19855129 Expression profiling demonstrated that the DCT-expressing cell population expressed adrenergic and muscarinic receptors and displayed transcriptional profiles distinct from dermal melanocytes
19284502 tyrosinase-related protein 2 (TRP-2) transcript is not detected in the peripheral blood mononuclear cells (PBMC) of vitiligo patients
18674612 TRP-2 acts on quinone metabolites other than DOPAchrome, e.g., in the catecholamine pathway, and limits their deleterious effects.
18337837 Tyrosinase-, gp100-, or TRP-2-specific CD8(+) T cells could not be identified in the peripheral blood of individuals with vitiligo [TRP-2].
18312627 We observe strong evidence for positive selection for DCT in Asians
18206123 we studied a possible role of dopachrome tautomerase in the oxidative stress response in the amelanotic WM35 melanoma cell line.
17766092 Anemonin, an active compound of C. crassifolia, inhibits melanin synthesis by inhibiting the transcription of the genes encoding TYR, TRP1, and TRP2.
17200659 No genetic susceptibility or increased risk attributed to the tyrosinase gene family in Vogt-Koyanagi-Harada disease in Japanese.
16857183 Transgenic Dct regulates neural progenitor cell proliferation in a mouse model.
15856458 Because TRP-2(181-190) overlaps with the known HLA-A*0201-presented epitope TRP-2(180-188), an 11mer peptide encompassing both epitopes might be of specific value for vaccination of a broad population of melanoma patients.
12559959 Data suggest that OTX2 may regulate retinal pigment epithelium (RPE)-specific target genes, such as DOPAchrome tautomerase (DCT), thereby maintaining the homeostasis of RPE.

AA Sequence

MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRP      1 - 70
WSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQ     71 - 140
FLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFS    141 - 210
HQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFS    211 - 280
SWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA    281 - 350
LEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQE    351 - 420
LAPIGHNRMYNMVPFFPPVTNEELFLTSDQLGYSYAIDLPVSVEETPGWPTTLLVVMGTLVALVGLFVLL    421 - 490
AFLQYRRLRKGYTPLMETHLSSKRYTEEA                                             491 - 519
//

Text Mined References (51)

PMID Year Title
25346513 2014 DCT protects human melanocytic cells from UVR and ROS damage and increases cell viability.
24709887 2014 Value of dopachrome tautomerase detection in the assessment of melanocytic tumors.
22988252 2012 Negative regulation of AMP-activated protein kinase (AMPK) activity by macrophage migration inhibitory factor (MIF) family members in non-small cell lung carcinomas.
22898827 2012 The changes of microRNA expression profiles and tyrosinase related proteins in MITF knocked down melanocytes.
20520707 2010 HIF-1 antagonizes p53-mediated apoptosis through a secreted neuronal tyrosinase.
20356546 2010 [Association study of Trp2 allele polymorphism with degenerative disc disease in a Chinese Han nationality].
20221248 2010 Association of the OCA2 polymorphism His615Arg with melanin content in east Asian populations: further evidence of convergent evolution of skin pigmentation.
19855129 2009 Melanocyte-like cells in the heart and pulmonary veins contribute to atrial arrhythmia triggers.
19284502 2009 Absence of tyrosinase-related protein-2/dopachrome tautomerase transcripts in PBMCs from vitiligo patients.
18674612 2008 TRP-2 expression protects HEK cells from dopamine- and hydroquinone-induced toxicity.
18337837 2008 Lack of functionally active Melan-A(26-35)-specific T cells in the blood of HLA-A2+ vitiligo patients.
18312627 2008 Complex signatures of selection for the melanogenic loci TYR, TYRP1 and DCT in humans.
18206123 2008 TRP-2 specifically decreases WM35 cell sensitivity to oxidative stress.
17766092 2008 Anemonin is a natural bioactive compound that can regulate tyrosinase-related proteins and mRNA in human melanocytes.
17200659 2006 Tyrosinase gene family and Vogt-Koyanagi-Harada disease in Japanese patients.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16857183 2006 Dopachrome tautomerase (Dct) regulates neural progenitor cell proliferation.
15856458 2005 Melanoma patients respond to a new HLA-A*01-presented antigenic ligand derived from a multi-epitope region of melanoma antigen TRP-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12843792 Molecular and functional analysis of tyrosinase-related protein (TRP)-2 as a cytotoxic T lymphocyte target in patients with malignant glioma.
12643545 Proteomic analysis of early melanosomes: identification of novel melanosomal proteins.
12559959 2003 OTX2 regulates expression of DOPAchrome tautomerase in human retinal pigment epithelium.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991713 2002 An evaluation of the assembly of an approximately 15-Mb region on human chromosome 13q32-q33 linked to bipolar disorder and schizophrenia.
11851878 2002 Increase of pro-opiomelanocortin mRNA prior to tyrosinase, tyrosinase-related protein 1, dopachrome tautomerase, Pmel-17/gp100, and P-protein mRNA in human skin after ultraviolet B irradiation.
11777994 2002 Pre-existing immunity to tyrosinase-related protein (TRP)-2, a new TRP-2 isoform, and the NY-ESO-1 melanoma antigen in a patient with a dramatic response to immunotherapy.
11549113 2001 Production of melanocyte-specific antibodies to human melanosomal proteins: expression patterns in normal human skin and in cutaneous pigmented lesions.
10886507 2000 Human melanocytes and melanomas express novel mRNA isoforms of the tyrosinase-related protein-2/DOPAchrome tautomerase gene: molecular and functional characterization.
10079069 1999 Crystal structure of human D-dopachrome tautomerase, a homologue of macrophage migration inhibitory factor, at 1.54 A resolution.
9743519 1998 Translation of a retained intron in tyrosinase-related protein (TRP) 2 mRNA generates a new cytotoxic T lymphocyte (CTL)-defined and shared human melanoma antigen not expressed in normal cells of the melanocytic lineage.
9540976 1998 Quantification of tyrosinase, TRP-1, and Trp-2 transcripts in human melanocytes by reverse transcriptase-competitive multiplex PCR--regulation by steroid hormones.
9480844 1998 Molecular cloning of human D-dopachrome tautomerase cDNA: N-terminal proline is essential for enzyme activation.
9356298 1997 Crystallization and preliminary X-ray analysis of human D-dopachrome tautomerase.
9176405 1997 Molecular detection of tumor-associated antigens shared by human cutaneous melanomas and gliomas.
8976176 1996 Identification of TRP-2 as a human tumor antigen recognized by cytotoxic T lymphocytes.
8950502 1996 Human ocular melanocytes and retinal pigment epithelial cells differ in their melanogenic properties in vivo and in vitro.
8898931 1996 A new enzyme activity in human blood cells and isolation of the responsible protein (D-dopachrome tautomerase) from erythrocytes.
8530077 1995 Chromosomal structure of the human TYRP1 and TYRP2 loci and comparison of the tyrosinase-related protein gene family.
8306979 1994 Molecular characterization of a human tyrosinase-related-protein-2 cDNA. Patterns of expression in melanocytic cells.
8267597 1993 Isolation of a new tautomerase monitored by the conversion of D-dopachrome to 5,6-dihydroxyindole.
8206391 1994 Sequence of the human dopachrome tautomerase-encoding TRP-2 cDNA.
8148378 1994 Molecular cloning and functional analysis of a cDNA coding for human DOPAchrome tautomerase/tyrosinase-related protein-2.
8126111 1993 Contribution of melanogenic proteins to the heterogeneous pigmentation of human melanocytes.
8088811 1994 Assignment of the tyrosinase-related protein-2 gene (TYRP2) to human chromosome 13q31-q32 by fluorescence in situ hybridization: extended synteny with mouse chromosome 14.
8040609 1994 High-molecular-weight forms of tyrosinase and the tyrosinase-related proteins: evidence for a melanogenic complex.
7929451 1994 Cloning of the human DOPAchrome tautomerase/tyrosinase-related protein 2 gene and identification of two regulatory regions required for its pigment cell-specific expression.
7858411 1994 Levels of dopachrome tautomerase in human melanocytes cultured in vitro.
7855064 1994 The presence of tyrosinase and related proteins in human epidermis and their relationship to melanin type.
1537334 1992 A second tyrosinase-related protein, TRP-2, maps to and is mutated at the mouse slaty locus.