Property Summary

NCBI Gene PubMed Count 26
PubMed Score 332.00
PubTator Score 69.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.318 1.9e-03
pancreatic ductal adenocarcinoma liver m... -1.356 8.2e-03
lung cancer 1.400 3.3e-04
ulcerative colitis 1.100 6.9e-05

Protein-protein Interaction (5)

Gene RIF (13)

PMID Text
26584588 Data show that decapping scavenger enzyme DcpS (DcpS) is a nucleocytoplasmic shuttling protein that activates microRNA (miRNA) degradation.
26241964 In DcpS, conformational change is dominated by an anti-symmetric cooperative motion, causing one active site to close as the other opens; however a symmetric motion is also significant.
26001796 data demonstrate that DcpS in conjunction with Xrn1 has the potential to regulate RNA stability in a transcript-selective manner in mammalian cells
25712129 DCPS and more generally RNA catabolism, are critical for neurological development, normal cognition and organismal homeostasis in humans.
25701870 In vitro decapping assays showed that altered EDC3 is unable to enhance DCP2 decapping at low concentrations and even inhibits DCP2 decapping at high concentration.
18725266 Data established that DcpS, a key enzyme in mRNA decay, is a new target of DeltaLf transcriptional activity.
18441014 biochemical analysis of the dynamic and mutually exclusive cap hydrolysis activity of the two cap binding sites of DcpS
18426921 These studies demonstrate that the significance of DcpS extends beyond its well-characterized role in mRNA decay and involves a broader range of functions in RNA processing including nuclear pre-mRNA splicing.
16140270 Furthermore, we show that a novel human histidine triad protein DCS-1, which is expressed together with NR1 in many tissues, can significantly reduce menadione-induced cytotoxicity in these cells
15769464 crystal structures of DcpS in ligand-free form and in a complex with m7GDP
15068804 Structural and biochemical analysis suggests an autoregulatory mechanism whereby premature decapping mRNA is prevented by blocking the conformational changes that are required to form a closed productive active site capable of cap hydrolysis.
14523240 m7GDP breakdown by DcpS should prevent misincorporation of methylated nucleotides in nucleic acids and could generate a unique indicator allowing the cell to monitor mRNA decay.
12198172 The central histidine within the DcpS HIT motif is critical for decapping activity and defines the HIT motif as a new mRNA decapping domain, making DcpS the first member of the HIT family of proteins with a defined biological function.

AA Sequence

MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNE      1 - 70
ASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHL     71 - 140
QKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQ    141 - 210
QQLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILHQGQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHF    211 - 280
TALGFEAPGSGVERAHLLAEVIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQS                 281 - 337
//

Text Mined References (33)

PMID Year Title
26584588 2015 The human decapping scavenger enzyme DcpS modulates microRNA turnover.
26241964 2015 Structure and Function in Homodimeric Enzymes: Simulations of Cooperative and Independent Functional Motions.
26001796 2015 DcpS is a transcript-specific modulator of RNA in mammalian cells.
25712129 2015 Loss of the scavenger mRNA decapping enzyme DCPS causes syndromic intellectual disability with neuromuscular defects.
25701870 2015 Mutations in DCPS and EDC3 in autosomal recessive intellectual disability indicate a crucial role for mRNA decapping in neurodevelopment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22985415 2012 7-methylguanosine diphosphate (m(7)GDP) is not hydrolyzed but strongly bound by decapping scavenger (DcpS) enzymes and potently inhibits their activity.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18839960 2008 DcpS as a therapeutic target for spinal muscular atrophy.
18725266 2009 Proteomic approach to the identification of novel delta-lactoferrin target genes: Characterization of DcpS, an mRNA scavenger decapping enzyme.
18441014 2008 Mechanistic and kinetic analysis of the DcpS scavenger decapping enzyme.
18426921 2008 DcpS scavenger decapping enzyme can modulate pre-mRNA splicing.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16140270 2005 Role of a novel dual flavin reductase (NR1) and an associated histidine triad protein (DCS-1) in menadione-induced cytotoxicity.
15769464 2005 Crystal structures of human DcpS in ligand-free and m7GDP-bound forms suggest a dynamic mechanism for scavenger mRNA decapping.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383679 2004 Nematode m7GpppG and m3(2,2,7)GpppG decapping: activities in Ascaris embryos and characterization of C. elegans scavenger DcpS.
15273322 2004 Functional analysis of mRNA scavenger decapping enzymes.
15068804 2004 Insights into the structure, mechanism, and regulation of scavenger mRNA decapping activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14523240 2003 DcpS can act in the 5'-3' mRNA decay pathway in addition to the 3'-5' pathway.
12871939 2003 Coordinate expression of NADPH-dependent flavin reductase, Fre-1, and Hint-related 7meGMP-directed hydrolase, DCS-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198172 2002 The scavenger mRNA decapping enzyme DcpS is a member of the HIT family of pyrophosphatases.
11747811 2001 Functional link between the mammalian exosome and mRNA decapping.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.