Property Summary

NCBI Gene PubMed Count 40
PubMed Score 87.71
PubTator Score 60.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Protein-protein Interaction (11)

Gene RIF (14)

AA Sequence

METKRVEIPGSVLDDFCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVF      1 - 70
SHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDC     71 - 140
AAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRN    141 - 210
DMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLF    211 - 280
PDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKNQSMRGNGRKQYQDSPNQKKRTNGLQPAKQQNSLMK    281 - 350
CEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL    351 - 420
//

Text Mined References (50)

PMID Year Title