Property Summary

NCBI Gene PubMed Count 38
PubMed Score 80.66
PubTator Score 60.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (14)

PMID Text
25870104 Human Dcp2 levels and activity are controlled by a competition between decapping complex assembly and Dcp2 degradation.
24510189 The data indicates that DCP2 activation by DCP1 occurs preferentially on the EDC4 scaffold, which may serve to couple DCP2 activation by DCP1 with 5'-to-3' mRNA degradation by XRN1 in human cells.
23926332 The efficiency of incorporation of Mov10, A3G, and A3F into viral particles, which contains both HIV-1 Gag and genomic RNA, is much higher than that of the other P-body proteins AGO2, DCP1a, DCP2, and DDX6
23115303 Data show that Y14 interacts directly with the decapping factor Dcp2 and the 5' cap structure of mRNAs via different but overlapping domains.
23085078 PNRC2 acts in synergy with Dcp1a to stimulate the decapping activity of Dcp2 by bridging the interaction between Dcp1a and Dcp2.
22851315 The efficiency of incorporation of Mov10, A3G, and A3F into viral particles, which contains both HIV-1 Gag and genomic RNA, is much higher than that of the other P-body proteins AGO2, DCP1a, DCP2, and DDX6
21070968 Like Dcp2, Nudt16 also regulates the stability of a subset of mRNAs including a member of the motin family of proteins involved in angiogenesis.
18854154 Knockdown of DCP2 decapping enzyme homolog (S. cerevisiae, DCP2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18361920 These data support the novel notion of the association between Ro52 with hDCP2 protein in cytoplasmic p-bodies, playing a role in mRNA metabolism in response to cellular stimulation.
18039849 hDcp2 can specifically bind to and can regulate the stability of a subset of mRNAs
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci
12486012 Human Dcp2 is a catalytically active mRNA decapping enzyme that localizes to the cytoplasm
12417715 These data suggest that a human decapping complex containing decapping enzymes hDcp1a and hDcp2 may be recruited to mRNAs containing premature termination codons by the hUpf proteins.
12218187 an mRNA decapping enzyme demonstrated to contain intrinsic decapping activity

AA Sequence

METKRVEIPGSVLDDFCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVF      1 - 70
SHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDC     71 - 140
AAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRN    141 - 210
DMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLF    211 - 280
PDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKNQSMRGNGRKQYQDSPNQKKRTNGLQPAKQQNSLMK    281 - 350
CEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL    351 - 420
//

Text Mined References (47)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26098573 2015 A conserved mechanism of TOR-dependent RCK-mediated mRNA degradation regulates autophagy.
25870104 2015 Competition between Decapping Complex Formation and Ubiquitin-Mediated Proteasomal Degradation Controls Human Dcp2 Decapping Activity.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24510189 2014 The activation of the decapping enzyme DCP2 by DCP1 occurs on the EDC4 scaffold and involves a conserved loop in DCP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23115303 2013 The RNA-binding protein Y14 inhibits mRNA decapping and modulates processing body formation.
23085078 2012 Structural basis of the PNRC2-mediated link between mrna surveillance and decapping.
22890540 2012 New azaphilones and chlorinated phenolic glycosides from Chaetomium elatum with caspase-3 inhibitory activity.
21876179 2011 Zinc-finger antiviral protein inhibits HIV-1 infection by selectively targeting multiply spliced viral mRNAs for degradation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21070968 2010 Multiple mRNA decapping enzymes in mammalian cells.
20616046 2010 LIM-domain proteins, LIMD1, Ajuba, and WTIP are required for microRNA-mediated gene silencing.
20584987 2010 Human Pat1b connects deadenylation with mRNA decapping and controls the assembly of processing bodies.
20543818 2010 The C-terminal alpha-alpha superhelix of Pat is required for mRNA decapping in metazoa.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18361920 2008 SSA/Ro52 autoantigen interacts with Dcp2 to enhance its decapping activity.
18326031 2008 The AU-rich element mRNA decay-promoting activity of BRF1 is regulated by mitogen-activated protein kinase-activated protein kinase 2.
18172165 2008 Degradation of histone mRNA requires oligouridylation followed by decapping and simultaneous degradation of the mRNA both 5' to 3' and 3' to 5'.
18039849 2008 Transcript-specific decapping and regulated stability by the human Dcp2 decapping protein.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16756390 2006 Translation repression in human cells by microRNA-induced gene silencing requires RCK/p54.
16699599 2006 Human retroviral host restriction factors APOBEC3G and APOBEC3F localize to mRNA processing bodies.
16364915 2005 Multiple processing body factors and the ARE binding protein TTP activate mRNA decapping.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15937477 2005 MicroRNA-dependent localization of targeted mRNAs to mammalian P-bodies.
15687258 2005 Recruitment and activation of mRNA decay enzymes by two ARE-mediated decay activation domains in the proteins TTP and BRF-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15273322 2004 Functional analysis of mRNA scavenger decapping enzymes.
15231747 2004 A protein interaction framework for human mRNA degradation.
15067023 2004 Cytoplasmic foci are sites of mRNA decay in human cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14527413 2003 Nonsense-mediated mRNA decay in mammalian cells involves decapping, deadenylating, and exonucleolytic activities.
12923261 2003 Functional characterization of the mammalian mRNA decapping enzyme hDcp2.
12768200 2003 Visualizing an mRNA destruction line.
12515382 2002 The human LSm1-7 proteins colocalize with the mRNA-degrading enzymes Dcp1/2 and Xrnl in distinct cytoplasmic foci.
12486012 2002 Human Dcp2: a catalytically active mRNA decapping enzyme located in specific cytoplasmic structures.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417715 2002 Identification of a human decapping complex associated with hUpf proteins in nonsense-mediated decay.
12218187 2002 The hDcp2 protein is a mammalian mRNA decapping enzyme.
9490301 1998 Cloning and tissue expression of cDNAs from chromosome 5q21-22 which is frequently deleted in advanced lung cancer.