Property Summary

NCBI Gene PubMed Count 82
PubMed Score 184.89
PubTator Score 69.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.262 2.2e-05
astrocytic glioma 1.400 6.0e-03
chronic lymphosyte leukemia 1.100 2.6e-04
ependymoma 1.500 1.7e-03
hepatocellular carcinoma 1.100 3.9e-05
intraductal papillary-mucinous carcinoma... 1.400 8.8e-03
intraductal papillary-mucinous neoplasm ... 1.400 2.5e-02
lung cancer 2.000 8.2e-03
oligodendroglioma 1.500 5.8e-04
osteosarcoma -1.199 5.0e-04
ovarian cancer -1.200 1.0e-05
pancreatic ductal adenocarcinoma liver m... 1.966 1.9e-03

 GWAS Trait (1)

Gene RIF (62)

AA Sequence

MSSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLYCSPVTKELLL      1 - 70
TSPKYRFWKKRIISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSVMFLFQGNNGTVLYTGDFRLA     71 - 140
QGEAARMELLHSGGRVKDIQSVYLDTTFCDPRFYQIPSREECLSGVLELVRSWITRSPYHVVWLNCKAAY    141 - 210
GYEYLFTNLSEELGVQVHVNKLDMFRNMPEILHHLTTDRNTQIHACRHPKAEEYFQWSKLPCGITSRNRI    211 - 280
PLHIISIKPSTMWFGERSRKTNVIVRTGESSYRACFSFHSSYSEIKDFLSYLCPVNAYPNVIPVGTTMDK    281 - 350
VVEILKPLCRSSQSTEPKYKPLGKLKRARTVHRDSEEEDDYLFDDPLPIPLRHKVPYPETFHPEVFSMTA    351 - 420
VSEKQPEKLRQTPGCCRAECMQSSRFTNFVDCEESNSESEEEVGIPASLQGDLGSVLHLQKADGDVPQWE    421 - 490
VFFKRNDEITDESLENFPSSTVAGGSQSPKLFSDSDGESTHISSQNSSQSTHITEQGSQGWDSQSDTVLL    491 - 560
SSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKDTYSDLKSRDKDVTIVPSTGEPTTLSSETHI    561 - 630
PEEKSLLNLSTNADSQSSSDFEVPSTPEAELPKREHLQYLYEKLATGESIAVKKRKCSLLDT            631 - 692
//

Text Mined References (84)

PMID Year Title