Property Summary

NCBI Gene PubMed Count 28
PubMed Score 14.81
PubTator Score 31.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Malignant neoplasm of breast 63
Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 2.0
Disease Target Count Z-score Confidence
Dyskeratosis congenita 24 0.0 4.0
Disease Target Count Z-score Confidence
Fanconi's anemia 50 4.389 2.2
Disease Target Count
HOYERAAL-HREIDARSSON SYNDROME 7

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.100 2.0e-03
osteosarcoma -1.202 3.2e-03
group 3 medulloblastoma 1.600 5.9e-04
medulloblastoma, large-cell 1.100 5.3e-03
pancreatic carcinoma 1.100 2.0e-03
gastric carcinoma 1.100 4.1e-02

Gene RIF (16)

PMID Text
26582912 Different charge distributions along the DNA binding groove may account for the drastic difference in processivity and DNA digestion efficiency, including that of damaged substrates, between SNM1A and SNM1B.
23863462 The SNM1B/APOLLO DNA nuclease functions in resolution of replication stress and maintenance of common fragile site stability.
23189151 the N-terminal region of Snm1B forms a complex containing PSF2 and Mus81, while the C-terminal region is important for PSF2-mediated chromatin association.
22907656 The nuclease hSNM1B/Apollo is linked to the Fanconi anemia pathway via its interaction with FANCP/SLX4.
22692201 differences in the substrate selectivities of SNM1A and SNM1B are likely to be relevant to their in vivo roles
21478198 SNM1B functions epistatically to the central Fanconi anemia factor, FANCD2, in cellular survival after interstrand crosslinks damage and homology-directed repair of DNA double-strand breaks
20655466 TRF2, which binds preferentially to positively supercoiled DNA substrates, together with Apollo, negatively regulates the amount of TOP1, TOP2alpha, and TOP2beta at telomeres.
19411856 DCLRE1B protein binds to a C-terminal fragment of HSP72 Heat-Shock Proteins, known to contain the substrate binding domain.
19197158 Results suggest that SNM1B/Apollo and Astrin function together to enforce the prophase checkpoint in response to spindle stress.
18593705 The protein hSnm1B is stabilized when bound to the telomere-binding protein TRF2
18469862 Snm1B interacts with the Mre11-Rad50-Nbs1 (MRN) complex and with FancD2 further substantiating its role as a checkpoint/DNA repair protein.
18468965 observations suggest an important role for hSNM1B in the response to ionizing radiation damage, a role that may be, in part, upstream of the central player in maintenance of genome integrity, ATM
16730176 SNM1B (Apollo) is an Artemis-like nuclease that is required for the protection of telomeres during or after their replication. [Apollo]
16730175 SNM1B (Apollo) protein exhibits a 5'-to-3' DNA exonuclease activity and functions together with TRF2 to protect telomeres from damage and fusion.
16606622 the C terminus of Snm1B was shown to interact with the TRF homology domain of TRF2 indicating that Snm1B is likely recruited to the telomere via interaction with the double-stranded telomere-binding protein TRF2
15467758 siRNA knockdown of hSNM1B rendered cells sensitive to ionizing radiation, suggesting the possibility of hSNM1B involvement in homologous recombination repair of double-strand breaks arising as intermediates of ICL repair

AA Sequence

MNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQ      1 - 70
ALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIH     71 - 140
TLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLEL    141 - 210
VQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYS    211 - 280
ELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQ    281 - 350
GVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQK    351 - 420
RVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGT    421 - 490
PLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC                                491 - 532
//

Text Mined References (30)

PMID Year Title
26582912 2015 The structures of the SNM1A and SNM1B/Apollo nuclease domains reveal a potential basis for their distinct DNA processing activities.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23863462 2013 The SNM1B/APOLLO DNA nuclease functions in resolution of replication stress and maintenance of common fragile site stability.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23189151 2012 Snm1B interacts with PSF2.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22907656 2012 The nuclease hSNM1B/Apollo is linked to the Fanconi anemia pathway via its interaction with FANCP/SLX4.
22692201 2012 Characterization of the human SNM1A and SNM1B/Apollo DNA repair exonucleases.
21478198 2011 Snm1B/Apollo functions in the Fanconi anemia pathway in response to DNA interstrand crosslinks.
20655466 2010 TRF2 and apollo cooperate with topoisomerase 2alpha to protect human telomeres from replicative damage.
20479256 2010 Function of Apollo (SNM1B) at telomere highlighted by a splice variant identified in a patient with Hoyeraal-Hreidarsson syndrome.
19411856 2009 Evidence for hSNM1B/Apollo functioning in the HSP70 mediated DNA damage response.
19197158 2009 SNM1B/Apollo interacts with astrin and is required for the prophase cell cycle checkpoint.
19135898 2009 Purification of proteins associated with specific genomic Loci.
18593705 2008 The protein hSnm1B is stabilized when bound to the telomere-binding protein TRF2.
18469862 2008 Snm1B/Apollo mediates replication fork collapse and S Phase checkpoint activation in response to DNA interstrand cross-links.
18468965 2008 Endogenous hSNM1B/Apollo interacts with TRF2 and stimulates ATM in response to ionizing radiation.
18202258 2008 A shared docking motif in TRF1 and TRF2 used for differential recruitment of telomeric proteins.
16730176 2006 Apollo, an Artemis-related nuclease, interacts with TRF2 and protects human telomeres in S phase.
16730175 2006 The Apollo 5' exonuclease functions together with TRF2 to protect telomeres from DNA repair.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16606622 2006 hSnm1B is a novel telomere-associated protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15572677 2004 DNA cross-link repair protein SNM1A interacts with PIAS1 in nuclear focus formation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467758 2004 Human SNM1B is required for normal cellular response to both DNA interstrand crosslink-inducing agents and ionizing radiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10848582 2000 Disruption of mouse SNM1 causes increased sensitivity to the DNA interstrand cross-linking agent mitomycin C.