Property Summary

Ligand Count 5
NCBI Gene PubMed Count 9
PubMed Score 205.93
PubTator Score 31.20

Knowledge Summary

Patent (11,307)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.300 4.0e-03
Astrocytoma, Pilocytic -1.300 7.6e-05
atypical teratoid / rhabdoid tumor -1.700 1.0e-08
ependymoma -1.100 4.9e-09
glioblastoma -1.100 1.6e-06
medulloblastoma -1.200 2.3e-03
medulloblastoma, large-cell -1.600 1.6e-03
primitive neuroectodermal tumor -1.100 1.6e-02

Gene RIF (1)

AA Sequence

MGKEPLTLKSIQVAVEELYPNKARALTLAQHSRAPSPRLRSRLFSKALKGDHRCGETETPKSCSEVAGCK      1 - 70
AAMRHQGKIPEELSLDDRARTQKKWGRGKWEPEPSSKPPREATLEERHARGEKHLGVEIEKTSGEIIRCE     71 - 140
KCKRERELQQSLERERLSLGTSELDMGKGPMYDVEKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNP    141 - 210
TQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREH    211 - 280
QAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKLEKEPKTRPEENKPERPSGRKPRPMGIIAA    281 - 350
NVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILIIQSLSHPNIVKLHEV    351 - 420
YETDMEIYLILEYVQGGDLFDAIIESVKFPEPDAALMIMDLCKALVHMHDKSIVHRDLKPENLLVQRNED    421 - 490
KSTTLKLADFGLAKHVVRPIFTVCGTPTYVAPEILSEKGYGLEVDMWAAGVILYILLCGFPPFRSPERDQ    491 - 560
DELFNIIQLGHFEFLPPYWDNISDAAKDLVSRLLVVDPKKRYTAHQVLQHPWIETAGKTNTVKRQKQVSP    561 - 630
SSEGHFRSQHKRVVEQVS                                                        631 - 648
//

Text Mined References (10)

PMID Year Title