Property Summary

NCBI Gene PubMed Count 58
PubMed Score 113.95
PubTator Score 61.03

Knowledge Summary

Patent (15,082)

TINX Plot

  Disease (5)

Disease Target Count P-value
breast carcinoma 1614 7.4e-22
oligodendroglioma 2849 5.9e-16
lung carcinoma 2844 6.8e-12
ovarian cancer 8491 1.7e-11
Duchenne muscular dystrophy 602 7.3e-10
malignant mesothelioma 3163 1.7e-08
Amyotrophic Lateral Sclerosis 432 4.5e-08
juvenile dermatomyositis 1189 5.4e-08
pilocytic astrocytoma 3086 5.7e-07
acute quadriplegic myopathy 1157 1.4e-06
glioblastoma 5572 1.8e-06
colon cancer 1475 1.9e-06
limb girdle muscular dystrophy 2A 156 3.2e-06
pediatric high grade glioma 2712 1.3e-05
lung cancer 4473 7.3e-05
psoriasis 6685 9.6e-05
pituitary cancer 1972 1.1e-04
atypical teratoid / rhabdoid tumor 4369 2.7e-04
primary Sjogren syndrome 788 3.8e-04
cystic fibrosis 1670 4.6e-04
invasive ductal carcinoma 2950 4.8e-04
intraductal papillary-mucinous adenoma (IPMA) 2956 7.8e-04
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.8e-04
fascioscapulohumeral muscular dystrophy 100 1.1e-03
medulloblastoma 1524 1.3e-03
Atopic dermatitis 944 1.8e-03
medulloblastoma, large-cell 6234 4.9e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 499 7.0e-03
Becker muscular dystrophy 187 7.4e-03
Parkinson's disease 364 8.7e-03
ductal carcinoma in situ 1745 8.9e-03
subependymal giant cell astrocytoma 2287 9.8e-03
interstitial cystitis 2299 1.0e-02
Down syndrome 548 1.1e-02
astrocytic glioma 2241 1.2e-02
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.5e-02
Pick disease 1893 1.5e-02
diabetes mellitus 1663 1.9e-02
Breast cancer 3098 2.6e-02
ependymoma 2514 4.1e-02
primitive neuroectodermal tumor 3031 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Asthma 349 0.0 1.0
Glaucoma 135 0.0 2.0
Disease Target Count Z-score Confidence
Lissencephaly 61 4.397 2.2
Cancer 2346 3.545 1.8

Expression

  Differential Expression (41)

Disease log2 FC p
malignant mesothelioma -3.500 1.7e-08
astrocytic glioma 2.400 1.2e-02
ependymoma 2.300 4.1e-02
oligodendroglioma -2.300 5.9e-16
psoriasis -1.700 9.6e-05
glioblastoma -3.900 1.8e-06
atypical teratoid / rhabdoid tumor -3.600 2.7e-04
medulloblastoma -1.800 1.3e-03
medulloblastoma, large-cell -3.000 4.9e-03
primitive neuroectodermal tumor -1.300 4.7e-02
Duchenne muscular dystrophy 3.564 7.3e-10
Amyotrophic Lateral Sclerosis 3.475 4.5e-08
acute quadriplegic myopathy 3.556 1.4e-06
limb girdle muscular dystrophy 2A 2.639 3.2e-06
Becker muscular dystrophy 2.109 7.4e-03
autosomal dominant Emery-Dreifuss muscul... 2.061 7.0e-03
fascioscapulohumeral muscular dystrophy 1.299 1.1e-03
juvenile dermatomyositis 2.200 5.4e-08
Atopic dermatitis -2.100 1.8e-03
intraductal papillary-mucinous adenoma (... -3.200 7.8e-04
intraductal papillary-mucinous carcinoma... -3.300 9.8e-04
intraductal papillary-mucinous neoplasm ... -3.100 1.5e-02
lung cancer -2.400 7.3e-05
colon cancer -3.200 1.9e-06
Parkinson's disease -1.500 8.7e-03
breast carcinoma -1.500 7.4e-22
diabetes mellitus -1.200 1.9e-02
interstitial cystitis 1.600 1.0e-02
cystic fibrosis -2.100 4.6e-04
pediatric high grade glioma -2.800 1.3e-05
pilocytic astrocytoma -3.900 5.7e-07
primary Sjogren syndrome 1.600 3.8e-04
subependymal giant cell astrocytoma 3.170 9.8e-03
Breast cancer -1.600 2.6e-02
invasive ductal carcinoma -2.700 4.8e-04
lung carcinoma 1.800 6.8e-12
Pick disease -1.500 1.5e-02
ductal carcinoma in situ -1.600 8.9e-03
ovarian cancer -2.300 1.7e-11
pituitary cancer -2.800 1.1e-04
Down syndrome -1.100 1.1e-02

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (28)

PMID Text
26764906 DCLK1 is essential for the invasive and metastatic properties of pancreatic cancer stem cells.
26468984 DCLK1 controls these complex cellular signaling pathways to regulate hepatocellular carcinoma growth, and may be used as a prognostic biomarker.
26447334 Data suggest that doublecortin and CaM kinase-like 1 protein short-transcripts (DCLK1-S) may represent an important target for preventing/inhibiting colon-cancers, and for eliminating colon-cancer-stem-cells (CSCs).
25948779 results provide new insights into the molecular mechanism of the hepatitis B/C-virus induced liver inflammation and tumorigenesis via DCLK1-controlled networks
25723399 Doublecortin-like kinase 1 is elevated serologically in pancreatic ductal adenocarcinoma and widely expressed on circulating tumor cells.
25631749 the higher expression level of DCLK1 in patients undergoing CRT can propose it as a more relevant candidate among CSC markers comparing to Lgr5 for colorectal cancer patients.
25605241 Data indicate that doublecortin-like kinase 1 (DCLK1) is overexpressed and has a unique methylation signature in renal clear cell carcinoma (RCC).
25283374 Increased expression of DCLK1 was observed in the epithelium, stroma and plasma of patients with Barrett's esophagus and esophageal adenocarcinoma.
24880079 XMD8-92 treatment results in inhibition of DCLK1 and downstream oncogenic pathways.
24626093 RNA interference-mediated silencing of DCLK1 triggers apoptotic cell death of colon cancer cells in vitro and in vivo.
24384857 Potential exist for DCLK1 as a colorectal cancer biomarker for early detection, but may also have clinical implications regarding the previously proposed therapy toward DCLK1-positive cancer cells.
24260365 DCLK1 mRNA levels were considerably reduced during FLV treatment.
24096005 Human pancreatic ductal adenocarcinoma cells contain morphologically and functionally distinct subpopulations, expressing DCLK1, that have cancer stem cell-like properties.
24040120 DCLK1 regulates pluripotency and angiogenic factors via microRNA-dependent mechanisms in pancreatic cancer.
23918955 DCAMKL1 represses osteoblast activation by antagonizing Runx2, the master transcription factor in osteoblasts.
23202126 Dclk1 distinguishes between tumor and normal stem cells in the intestine.
22749579 DCAMKL-1 marks a subset of colorectal stem cells, as well as a subset of entero-endocrine cells.
22539971 Several DCLK1 variants were associated with disease phenotypes for rs7989807 in intron 3 (combination of SCZ, ADHD and BP), intron 19 (SCZ+BP) and the 3'UTR (SCZ+BP).
21937640 High DCAMKL1 is associated with HCV-induced hepatocarcinogenesis.
21916995 the progressive increase of DCAMKL-1 expression in Barrett's esophagus from dysplasia to esophageal adenocarcinoma
21493956 Eight suggestive significant loci were detected with a series of genes expressed within the inner ear that underlie the auditory function, such as: DCLK1, PTPRD, GRM8, CMIP.
21285251 Data show that siRNA-mediated knockdown of DCAMKL-1 in pancreatic cancer cells induced microRNA miR-200a, an EMT inhibitor, along with downregulation of EMT-associated transcription factors.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20228126 Together, our results suggest that silencing the DCLK splice variants DCL and DCLK-long induces apoptosis in NB cells.
19844571 Observational study of gene-disease association. (HuGE Navigator)
12692530 an examination of the binding sites on this protein
12595708 high-quality wild-type crystals of doublecortin-like kinase were obtained and a complete native data set was collected to 1.5 A resolution
11884394 genomic organization underlying the splice variants of DCLK and the expression profile of two splice variants affecting the kinase domain of DCLK and CPG16 (candidate plasticity gene 16).

AA Sequence

MSFGRDMELEHFDERDKAQRYSRGSRVNGLPSPTHSAHCSFYRTRTLQTLSSEKKAKKVRFYRNGDRYFK      1 - 70
GIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKL     71 - 140
EYTKNVNPNWSVNVKTTSASRAVSSLATAKGSPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTA    141 - 210
HSFEQVLTDITDAIKLDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVK    211 - 280
STSYTKIASSSRRSTTKSPGPSRRSKSPASTSSVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRSSQHG    281 - 350
GSSTSLASTKVCSSMDENDGPGEEVSEEGFQIPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKI    351 - 420
IKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASG    421 - 490
MLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIA    491 - 560
ETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELITMMLLV    561 - 630
DVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRR    631 - 700
RNQDVRSRYKAQPAPPELNSESEDYSPSSSETVRSPNSPF                                  701 - 740
//

Text Mined References (62)

PMID Year Title
26764906 2016 Dominant Expression of DCLK1 in Human Pancreatic Cancer Stem Cells Accelerates Tumor Invasion and Metastasis.
26468984 2015 Plasma DCLK1 is a marker of hepatocellular carcinoma (HCC): Targeting DCLK1 prevents HCC tumor xenograft growth via a microRNA-dependent mechanism.
26447334 2015 Epigenetic changes and alternate promoter usage by human colon cancers for expressing DCLK1-isoforms: Clinical Implications.
25948779 2015 Inflammatory and oncogenic roles of a tumor stem cell marker doublecortin-like kinase (DCLK1) in virus-induced chronic liver diseases.
25723399 2015 Doublecortin-like kinase 1 is elevated serologically in pancreatic ductal adenocarcinoma and widely expressed on circulating tumor cells.
25631749 2015 Upregulation of circulating cancer stem cell marker, DCLK1 but not Lgr5, in chemoradiotherapy-treated colorectal cancer patients.
25605241 2015 DCLK1 is a broadly dysregulated target against epithelial-mesenchymal transition, focal adhesion, and stemness in clear cell renal carcinoma.
25283374 2015 DCLK1 is detectable in plasma of patients with Barrett's esophagus and esophageal adenocarcinoma.
24880079 2014 XMD8-92 inhibits pancreatic tumor xenograft growth via a DCLK1-dependent mechanism.
24626093 2014 Curcumin promotes autophagic survival of a subset of colon cancer stem cells, which are ablated by DCLK1-siRNA.
24384857 2014 The recently suggested intestinal cancer stem cell marker DCLK1 is an epigenetic biomarker for colorectal cancer.
24260365 2013 Fluvastatin interferes with hepatitis C virus replication via microtubule bundling and a doublecortin-like kinase-mediated mechanism.
24096005 2014 DCLK1 marks a morphologically distinct subpopulation of cells with stem cell properties in preinvasive pancreatic cancer.
24040120 2013 DCLK1 regulates pluripotency and angiogenic factors via microRNA-dependent mechanisms in pancreatic cancer.
23918955 2013 The microtubule-associated protein DCAMKL1 regulates osteoblast function via repression of Runx2.
23535911 2013 Genome-wide scan revealed that polymorphisms in the PNPLA3, SAMM50, and PARVB genes are associated with development and progression of nonalcoholic fatty liver disease in Japan.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23202126 2013 Dclk1 distinguishes between tumor and normal stem cells in the intestine.
22749579 2012 Immunolocalization of DCAMKL-1, a putative intestinal stem cell marker, in normal colonic tissue.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22560479 2012 Genome-wide association study of the age of onset of childhood asthma.
22539971 2012 DCLK1 variants are associated across schizophrenia and attention deficit/hyperactivity disorder.
21998595 2011 Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry.
21937640 2011 Hepatitis C virus-induced cancer stem cell-like signatures in cell culture and murine tumor xenografts.
21916995 2012 Identification of the putative intestinal stem cell marker doublecortin and CaM kinase-like-1 in Barrett's esophagus and esophageal adenocarcinoma.
21493956 2011 Hearing function and thresholds: a genome-wide association study in European isolated populations identifies new loci and pathways.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21285251 2011 DCAMKL-1 regulates epithelial-mesenchymal transition in human pancreatic cells through a miR-200a-dependent mechanism.
20548946 2010 A genome-wide association study of optic disc parameters.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20236041 2010 The doublecortin gene family and disorders of neuronal structure.
20228126 2010 Silencing of the microtubule-associated proteins doublecortin-like and doublecortin-like kinase-long induces apoptosis in neuroblastoma cells.
19844571 2009 Variants in doublecortin- and calmodulin kinase like 1, a gene up-regulated by BDNF, are associated with memory and general cognitive abilities.
18052980 2007 A potential role for calcium / calmodulin-dependent protein kinase-related peptide in neuronal apoptosis: in vivo and in vitro evidence.
17975023 2008 The microtubule-associated protein doublecortin-like regulates the transport of the glucocorticoid receptor in neuronal progenitor cells.
17903306 2007 Genome-wide association study of electrocardiographic and heart rate variability traits: the Framingham Heart Study.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17313568 2007 Doublecortin-like, a microtubule-associated protein expressed in radial glia, is crucial for neuronal precursor division and radial process stability.
16869982 2006 The evolving doublecortin (DCX) superfamily.
16548883 2006 Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14741399 2004 Functional differences between two DCLK splice variants.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14613930 2004 Endofin recruits TOM1 to endosomes.
12692530 2003 The DCX-domain tandems of doublecortin and doublecortin-like kinase.
12595708 2003 Purification and crystallization of the N-terminal domain from the human doublecortin-like kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11884394 2002 Alternative splice variants of doublecortin-like kinase are differentially expressed and have different kinase activities.
11473121 2001 Cleavage of doublecortin-like kinase by calpain releases an active kinase fragment from a microtubule anchorage domain.
11124993 2000 DCAMKL1 encodes a protein kinase with homology to doublecortin that regulates microtubule polymerization.
10051403 1999 Genomic structure, chromosomal mapping, and expression pattern of human DCAMKL1 (KIAA0369), a homologue of DCX (XLIS).
10036192 1999 DCAMKL1, a brain-specific transmembrane protein on 13q12.3 that is similar to doublecortin (DCX).
9747029 1998 Expression and chromosomal localization of KIAA0369, a putative kinase structurally related to Doublecortin.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8515813 1993 Numerous candidate plasticity-related genes revealed by differential cDNA cloning.