Property Summary

Ligand Count 52
NCBI Gene PubMed Count 85
PubMed Score 455.39
PubTator Score 338.66

Knowledge Summary

Patent (21,949)

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 1.200 5.3e-06
gastric carcinoma 1.100 3.0e-02
medulloblastoma, large-cell -1.100 2.3e-03
osteosarcoma -2.034 2.1e-05
pituitary cancer 1.300 3.6e-06
primary Sjogren syndrome 2.300 7.1e-05
psoriasis -1.400 1.8e-04
sarcoidosis 1.300 1.7e-02
Waldenstrons macroglobulinemia 1.344 7.9e-03

Protein-protein Interaction (4)

PDB (44)

Gene RIF (70)

AA Sequence

MATPPKRSCPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEE      1 - 70
LTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASN     71 - 140
LYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHY    141 - 210
KHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL                        211 - 260
//

Text Mined References (99)

PMID Year Title